WWW.DISUS.RU

БЕСПЛАТНАЯ НАУЧНАЯ ЭЛЕКТРОННАЯ БИБЛИОТЕКА

 

Викторович физико-химические механизмы переноса ионов в природных и хирально модифицированных модел ь ных каналах

На правах рукописи

Дмитриев Андрей Викторович

Физико-химические механизмы переноса ионов в природных и хирально модифицированных модельных каналах

Специальность 03.00.02 – биофизика

АВТОРЕФЕРАТ

диссертации на соискание ученой степени

доктора физико-математических наук

Москва – 2008

Работа выполнена на кафедре гуманитарных и естественнонаучных дисциплин Филиала Орловской региональной академии государственной службы в г. Липецке

Научный консультант: доктор физико-математических наук, профессор Твердислов Всеволод Александрович
Официальные оппоненты: доктор физико-математических наук, ведущий научный сотрудник Быстров Владимир Сергеевич
доктор физико-математических наук, ведущий научный сотрудник Нечипуренко Юрий Дмитриевич
доктор физико-математических наук, профессор Шайтан Константин Вольдемарович
Ведущая организация: Институт биохимической физики им. Н.М.Эмануэля РАН

Защита состоится « __ » _____________ 2008 года в ___ часов на заседании Совета по защите диссертаций Д 501.001.96 по физико-математическим наукам при Московском государственном университете им. М.В. Ломоносова по адресу: Ленинские горы, Москва, ГСП-1, 119991, МГУ, Биологический факультет, кафедра биофизики, Новая аудитория.

С диссертацией можно ознакомиться в библиотеке

Биологического факультета МГУ им. М.В. Ломоносова

Автореферат разослан « ___ » _________________ 2008 года

Ученый секретарь

Диссертационного совета Д 501.001.96

доктор биологических наук, профессор Т.Е. Кренделева

ОБЩАЯ ХАРАКТЕРИСТИКА РАБОТЫ

Актуальность работы.

Одной из важнейших особенностей живой природы на Земле является «хиральная чистота» аминокислот, углеводов, нуклеотидов и многих биологически активных веществ, составляющих все организмы. На атомно-молекулярном уровне организации природной клетки данное свойство проявляется в том, что ее нуклеиновые кислоты включают исключительно D-изомеры (дезокси)рибозы, а синтезируемые в рибосомах белки – L-изомеры аминокислот. Отметим также, что все углеводы включают D-изомеры, а все фосфолипиды являются L-изомерами. Относительно исключений из этого правила речь пойдет ниже.

Хиральная асимметрия биосферы непосредственным образом связана с другой фундаментальной асимметрией – ионной асимметрией в содержании важнейших катионов во внутренней среде клеток относительно внешней среды. Существуют близкие значения свободной энергии, необходимой для формирования хирально чистых биополимеров и ионной асимметрии клеток (Твердислов, Яковенко,2003). Возникновение таких асимметрий исходно связано с образованием предшественников живых клеток на неравновесной границе океан-атмосфера, где происходит фракционирование ионов и энантиомеров хиральных соединений. Асимметричное и неравновесное распределение катионов между первичными клетками и средой, а также хиральная асимметрия аминокислот и углеводов, характерные для биологических систем, возникли при спонтанном замыкании липидных пузырьков-везикул в «первичном бульоне» древнего океана в ходе образования аэрозолей, включавших морскую воду поверхностной пленки. В существующих живых системах эта связь опосредована через ион-транспортирующие системы мембран, в частности, ионные каналы и насосы.

Следует отметить, что помимо сахаров и аминокислот другие хиральные компоненты клетки в определенных случаях могут встречаться как в одной, так и в другой изомерной форме. В некоторых бактериях обнаружены L-сахара и D-аминокислоты. D-аминокислоты достаточно широко распространены в живой природе и, более того, входят в состав ряда биологически значимых коротких олигопептидов. Встречаются бактерии, которые содержат D-глютаминовую кислоту и D-Ala в своих клеточных стенках, а в организме человека вырабатывается в качестве нейромедиатора D-Ser. Некоторые пептидные антибиотики, а также плазма крови высших организмов, имеют в своем составе D-аминокислоты. Некоторые термофилы используют высокие концентрации D-Ala в качестве осморегулятора. В нервных клетках высших организмов находят D-Ala, D-Asp и D-Ser, иногда в значительных концентрациях. Поэтому в целом биологический мир не обнаруживает хиральной чистоты, но все, что относится к матричному синтезу полипептидов, характеризуется абсолютной хиральной чистотой.

Рассматривая общие структурные особенности природной клетки, целесообразно выделить два аспекта нарушения зеркальной симметрии живой природы. Во-первых, это эволюционно востребованная необходимость гомохиральности, во-вторых – эволюционно закрепившийся знак хиральности.

Физико-химические и биологические основы гомохиральности биополимеров в последнее время изучены достаточно разносторонне (Аветисов, Гольданский,1996; Чернавский,2000; Твердислов, Яковенко, 1992, 2007). Основы механизмов сопряжения ионной и хиральной асимметрий рассмотрены в работах Твердислова, Яковенко, Дмитриева (1988 - 2007).

Гомохиральность белков и нуклеиновых кислот в первую очередь определяет их стереоспецифичность – необходимое условие матричного синтеза. Существует связь между хиральностью (дезокси)рибозы и требованием комплементарности двойной спирали ДНК. Замена единичного природного D-нуклеотида в двунитевой структуре ДНК на зеркально сопряженный ему L-изомер приводит к образованию структуры с большей энергией, нарушению комплементарности хирально дефектной пары, причем данный дефект не является локальным, а разрушает значительную область двунитевой структуры.

Во-вторых, гомохиральность белков и нуклеиновых кислот обусловливает стабильность их структур, обеспечивающих их функционирование.

В-третьих, для биохимических преобразований гомохиральных соединений требуется гораздо меньший набор ферментов, чем для таких же преобразований гетерохиральных соединений. Так, для катализа двух оптических изомеров необходимы два белка, а для работы с рацемической смесью необходим удвоенный набор белков.

Несмотря на значительные успехи, достигнутые в области исследования гомохиральности биополимеров, физико-химическое и биологическое основы того, что белки-ферменты и нуклеиновые кислоты имеют строго определенный знак хиральности, остаются неизвестными. Так, согласно гипотезе спонтанной дерацемизации (Гольданский,Кузьмин,1989), повторение всей совокупности событий, приведших к появлению хиральной чистоты, с равным успехом способно привести к такой биосфере, которая использует D-аминокислоты и L-сахара. К такому же результату приводит гипотеза решающей роли глобального фактора преимущества, усиленная учетом слабых нейтральных токов.

Для объяснения выбора знака хиральности были проведены расчеты (Mason et al,1984), в которых было показано, что вклад слабых взаимодействий во взаимодействие электронов с ядром асимметрического центра хиральной молекулы приводит к относительному сдвигу энергий основных состояний энантиомеров. Несмотря на то, что для достаточно простых молекул (аминокислот и сахаров) величина данного сдвига исключительно мала (составляет 10-15–10-17 kT), наиболее важным результатом таких расчетов было то, что энергия основного состояния L-аминокислот и D-сахаров оказалась ниже, чем энергия их зеркальных антиподов. Кроме того, наблюдаются небольшие различия в кинетике реакций с участием L- и D-аминокислот (Фалсом,1982). Различие физико-химических свойств стереоизомеров некоторых аминокислот проявляется не только в кинетике реакций, но и термодинамически. Так, например, для L-Ala температура плавления 315-316°С, а для D-Ala – 291-293°С (CRC Hanbook of Chem. and Phys., 84 Ed., CRC Press, 2003-2004). Различие температур плавления в силу уравнения Вант-Гоффа приводит к различной зависимости растворимостей от температуры.

Нам представляется наиболее рациональным искать ответ, хотя бы частичный, на вопрос о выборе строго определенного знака хиральности живой природы по результатам:

– исследования структуры и механизмов функционирования хирально модифицированных модельных белков1

[1], построенных из D-аминокислот;

– исследования изменений первичной структуры природных белков до получения функционального соответствия их природным антиподам;

– исследования особенностей матричного синтеза неприродных антиподов соответствующих белков.

Вышесказанное объясняет перспективность построения хирально модифицированных модельных белков, включающих D-аминокислоты, а также исследования особенностей их матричного синтеза. Изучение структурно-функциональных свойств хирально модифицированных белков, а также особенностей их матричного синтеза, позволят получить, по крайней мере, частичный ответ на вопрос о выборе строго определенного знака хиральности в ходе предбиологической эволюции.

Очевидно, что при исследовании структуры и механизмов функционирования зеркальных антиподов биомолекул, практически невозможно охватить все их многообразие. Так, в Банке белковых структур2

[2] представлены более десятка тысяч белковых структур. Поэтому имеет смысл ограничиться исследованием определенного класса белков, в качестве которого мы использовали ионные каналы мембран: потенциал-независимый калиевый канал KcsA, потенциал-зависимый калиевый каналы KvAP, /, Kv1.2, а также NMDA-рецептор.

Выбор ионных каналов в качестве объектов исследования не является случайным и обусловлен он тем, что, как ранее отмечалось, существует достоверно установленная сопряженность клеточной ионной и молекулярной хиральной специфичности живых систем, реализуемая через различные ион-транспортирующие системы – насосы, каналы, модификаторы.

Цель и задачи исследования. Целью настоящего исследования являлось теоретическое исследование физико-химических механизмов переноса ионов в природных и хирально модифицированных модельных каналах с инвариантной и модифицированной аминокислотной последовательностью, а также гипотетических сценариев их матричного синтеза.

Для достижения цели исследования решались следующие задачи:

1) Разработка метода расчета энергетических профилей ионов в мембранных каналах, не требующего значительных затрат расчетного времени и предсказывающего с хорошей точностью функциональные характеристики каналов.

2) Построение хирально модифицированных модельных каналов с первичной структурой, инвариантной природным каналам, а также исследование их структуры и механизмов функционирования.

3) Исследование влияния изомеризации определенных аминокислотных остатков ионных каналов при старении организма на их структурные и функциональные характеристики.

4) Разработка метода построения структуры хирально модифицированных модельных каналов с модифицированной первичной структурой и функциональными характеристиками, адекватными характеристикам природных каналов.

5) Исследование гипотетических особенностей матричного синтеза хирально модифицированных модельных каналов, характеризующихся соответствием их функциональных характеристик аналогичным природным каналам.

Объект и предмет исследования. Объектом исследования являлись:

1) ионные каналы клетки (потенциал-независимый калиевый канал KcsA из Streptomyces lividans, потенциал-зависимый калиевый канал KvAP из Aeropyrum pernix, потенциал-зависимый калиевый канал Kv1.2 из Rattus norvegicus, комплекс - и -субъединицы калиевого канала из Homo sapiens);

2) NR1 активный центр NMDA-рецептора из Rattus norvegicus в комплексе с Gly, D-Ser и D-cSer;

3) модельные D-аминокислотные каналы с модифицированной и инвариантной природной первичной структурой.

Четвертичную структуру природных белков брали из Банка белковых структур. Выбор выше указанной группы каналов являлся не случайным, т.к. для них существуют надежные экспериментальные данные по структуре и функциональным характеристикам.

Предметом исследования являлись механизмы функционирования и матричного синтеза гипотетических хирально модифицированных модельных ионных каналов.

Предпосылки и направление исследования. Экспериментально обнаруженная и теоретически изучаемая изомеризация отдельных аминокислотных остатков каналов приведет не к ожидаемой инвариантности их третичной структуры, а к ее нарушению. Последнее обстоятельство является причиной изменения функциональных характеристик каналов. Для построения хирально модифицированных модельных каналов с природной функциональностью необходима модификация их первичной структуры. Рассматривая гипотетический сценарий матричного синтеза, можно предположить, что модификация первичной структуры приведет либо к изменению нуклеотидной последовательности генов ДНК, кодирующих данные каналы, либо к изменению генетического кода. Появление D-аминокислот в ионных каналах в процессе старения организма повлечет изменение их функциональных характеристик и в определенных случаях нарушение механизмов их функционирования.

Методология и методы проведенного научного исследования. В работе использовались как традиционные методы расчета энергетических профилей ионов (молекулярная механика, квантовая химия) и функциональных характеристик каналов (теория абсолютных скоростей реакций Эйринга), так и разработанные нами методы:

1) разделение дальних и ближних взаимодействий в расчетах энергетических профилей ионов в поре каналов;

2) «энергетическое выравнивание» третичных структур белков как метод построения хирально модифицированных модельных каналов с измененной первичной структурой, структурно и функционально эквивалентных соответствующим природным каналам.

Научная новизна и значимость полученных результатов. В результате исследований впервые:

1) Предложен расчетный метод, основанный на разделении ближних и дальних взаимодействий, позволяющий получать энергетические профили ионов в мембранных каналах. В данном методе использовано сопряжение квантовохимического расчета ближних взаимодействий и молекулярно-механического – дальних взаимодействий.

2) Использование полученных энергетических профилей дает возможность вычислять функциональные характеристики каналов с хорошей точностью, что показано на примере ионной специфичности калиевых каналов клетки.

3) Построены хирально модифицированные модельные каналы с инвариантной природной аминокислотной последовательностью, которые являются энергетически менее стабильными, чем их природные антиподы с нарушенными механизмами функционирования и функциональными характеристиками.

4) Предложен метод, основанный на вариации первичной структуры и энергетическом выравнивании третичных структур, позволяющий моделировать атомную структуру хирально модифицированного модельного канала с природной функциональностью, а построенные D-аминокислотные каналы являются энергетически эквивалентными соответствующим природным каналам с аналогичными функциональными характеристиками.

5) Предложена простейшая схема гипотетического сценария матричного синтеза D-изомеров каналов, участниками которого являются ДНК и РНК из L-сахаров, а также ферменты матричного синтеза из D-аминокислот. Характерными особенностями данного синтеза являются либо модифицированная нуклеотидная последовательность экзонов, либо дублетная таблица универсального генетического кода (для построения хирально модифицированных модельных ионных каналов с природной функциональностью достаточно десяти D-аминокислот).

6) Появление D-аминокислот в ионных каналах, связанное со старением организма, приводит к нарушению функциональных характеристик каналов и ферментативных свойств NMDA-рецептора.

Практическая значимость полученных результатов. Разработанные подходы позволяют исследовать механизмы функционирования мембранных каналов, моделировать атомные структуры хирально модифицированных модельных белков с природной функциональностью.

Установленные изменения в работе каналов, обусловленные изомеризацией некоторых аминокислот каналов в процессе старения организма или различного рода заболеваниями, позволяют наметить пути поиска эффективных лекарственных препаратов, в качестве активных центров которых служат рецепторы ионных каналов.

Учитывая, что значительное число заболеваний связано с «каналопатологиями» - нарушениями функционирования ионных каналов, полученные результаты и разработанные подходы могут быть использованы при разработке стратегии и средств лечения этих заболеваний. Полученные результаты могут применяться при исследовании биологического отклика организмов на изомеризацию каналов под воздействием антропогенных внешних факторов и для решения общих проблем хиральной безопасности биосферы.

Полученные результаты расширяют представления о физических механизмах происхождения хиральной асимметрии биосферы, функционирования ионных каналов и могут быть использованы в курсах лекций по биофизике, биохимии и физиологии в университетах и вузах медико-биологического профиля.

Основные положения диссертации, выносимые на защиту.

1) Обоснование метода разделения дальних и ближних взаимодействий в расчетах энергетических профилей, с помощью которого установлено, что в клетке с хирально модифицированными калиевыми каналами с природной первичной структурой будут нарушены многие биологические процессы, обусловленные функционированием калиевых ионных каналов (функциональные характеристики таких модельных каналов существенно отличаются от соответствующих характеристик природных каналов клетки), а также появление незначительного количества D-аминокислот в канале, связанное со старением организма, приводит к нарушению функциональных характеристик каналов.

2) Если модельные L-дизоксирибозные ДНК были бы построены из четырех нуклеотидов, то для обеспечения матричного синтеза хирально модифицированных каналов с модифицированной первичной структурой и природной функциональностью была бы достаточна дублетная таблица генетического кода для десяти D-аминокислот: G, A, S, C, D, N, K, H, F, P. Однако оптимальность реально существующего генетического кода и системы биосинтеза обусловлена более широкой вариабельностью структурно-функциональных возможностей белков.

Личный вклад соискателя. Выбор и обоснование научной тематики исследования, получение результатов, приведенных в диссертации, их анализ и интерпретация, как и основные публикации, сделаны при решающем участии соискателя.

Апробация работы. Результаты исследований по теме диссертации представлены на 3-й Региональной научно-технической конференции «Проблемы экологии и экологической безопасности ЦЧ РФ» (Липецк, 1999), 7-й Международной конференции «Математика. Компьютер. Образование» (Дубна, 2000), 3-м Всероссийском медицинском конгрессе (Ижевск, 2000), 3-м Сибирском конгрессе по прикладной и индустриальной математике (Новосибирск, 1998), 5-й Международной конференции «Физика в системе современного образования» (Санкт-Петербург, 1999), 3-й Всероссийский симпозиум «Математическое моделирование и компьютерные технологии» (Кисловодск, 1999), 4-м Сибирском конгрессе по прикладной и индустриальной математике (Новосибирск, 2000), 5-й Республиканской электронной научной конференции «Современные проблемы информатизации» (Воронеж, 2000), Международной конференции «Математика. Образование. Экология. Гендерные проблемы» (Воронеж, 2000), 4-й Международной научно-технической конференции «Физика и радиоэлектроника в медицине и экологии» (Владимир, 2000), Международной конференции «Биохимическая физика на рубеже столетий» (Москва, 2000), 2-й Региональной научной конференции по органической химии «Органическая химия на пороге третьего тысячелетия – итоги и перспективы» (Липецк, 2000), 5-й Пущинской конференции молодых ученых «Биология – наука 21-го века» (Пущино, 2001), 8-й Международной конференции "Математика. Компьютер. Образование» (Пущино, 2001), 2-й Конференции молодых ученых России с международным участием «Фундаментальные науки и прогресс клинической медицины» (Москва, 2001), 3-й Всероссийской научной конференции «Молекулярная физика неравновесных систем» (Иваново, 2001), Международном симпозиуме «Компьютерное обеспечение химических исследований» (Москва, 2001), 7th Scandinavian Symposium on Chemometrics (Copenhagen, 2001), XVIII Съезде физиологического общества им. И.П. Павлова (Казань, 2001), Школе-семинаре «Введение в многомерный анализ данных (проекционные методы)» (Москва, 2001), 3-й Всероссийской школе-конференции по квантовой и вычислительной химии им. В.А. Фока (Великий Новгород, 2001), Международной школе-конференции «Введение в многомерный анализ данных (проекционные методы)» (Кострома, 2002), 13th International Congress on Molecular Biology (Toronto, 2002), 8-м Всероссийском симпозиуме «Биоинформатика и компьютерное конструирование лекарств» (Москва, 2002), 6-й Пущинской школе-конференции молодых ученых «Биология – наука 21-го века» (Пущино, 2002), 3-й Всероссийской конференции «Молекулярное моделирование» (Москва, 2003), 4th Symposium on Multivariate Data Analysis (Moscow, 2003), 3-м Съезде биофизиков России (Воронеж, 2004), 4-й Всероссийской конференции «Молекулярное моделирование» (Москва, 2005), Международной конференции студентов, аспирантов и молодых ученых «Ломоносов-2005» (Москва, 2005), Международной научной конференции «Молекулярные, мембранные и клеточные основы функционирования биосистем» (Минск, 2006), 5-м Съезде Белорусского общественного объединения фотобиологов и биофизиков (Минск, 2006), Всероссийской научной конференции «Актуальные проблемы естественных наук и их преподавания» (Липецк, 2006), 5-й Всероссийской конференции «Молекулярное моделирование» (Москва, 2007), 3-м Всероссийском съезде фармакологов (Санкт-Петербург, 2007), 5-м Международном семинаре «Компьютерное моделирование электромагнитных процессов в физических, химических и технических системах» (Воронеж, 2007).

Опубликованность результатов. По материалам диссертации опубликовано 72 печатные работы: 24 статьи в рецензируемых научных журналах по списку ВАК, в международных рецензируемых журналах – 3, статьи в других журналах, изданиях и тематических сборниках – 17, в материалах конференций – 28. Список основных работ по теме диссертации приведен в конце автореферата.

Структура и объем диссертации. Диссертация включает введение, основную часть, состоящую из 4 глав, заключение, основные выводы и список цитируемой литературы. Диссертация изложена на 243 страницах, содержит 59 рисунков и 36 таблиц.

ОСНОВНОЕ СОДЕРЖАНИЕ РАБОТЫ

В первой главе рассмотрены возможности и ограничения методов расчета и анализа энергетических профилей ионов в мембранных каналах. Исследованы прогностические способности метода молекулярной механики для их расчета. Предложен, обоснован и тестирован метод расчета энергетических профилей ионов, основанный на разделении и независимом расчете энергии дальних и ближних взаимодействий в системе ион – аминокислотный остаток остова канала.

Движение иона в трансмембранном канале однозначно контролируется функцией его потенциальной энергии, которая в явном виде включена во все уравнения, описывающие ионный транспорт в канале (молекулярной и ланжевеновой динамики, Пуассона-Нернста-Планка). Для оценки функциональных характеристик канала кинетическая теория переходного состояния Эйринга использует профиль свободной энергии Гиббса, одной из составляющих которого является потенциальная энергия иона.

При однорядном прохождении ионов через пору канала потенциальная энергия иона зависит от координаты оси канала (оси аксиальной симметрии) . Традиционно для расчета применяются либо методы молекулярной механики, либо квантовой химии. Методы молекулярной механики в данных расчетах не требуют значительных затрат расчетного времени, но их точность не всегда является удовлетворительной. Большинство расчетных методов квантовой химии лишены последнего недостатка, но требуют значительных затрат расчетного времени.

Вопрос о точности оценки энергетического профиля иона в поре канала является наиболее сложным в исследованиях ионного транспорта, что, прежде всего, обусловлено невозможностью прямого сопоставления расчетного профиля с экспериментальным. В этом случае по полученным энергетическим профилям осуществляется оценка функциональных характеристик канала, которые возможно сопоставить с экспериментальными значениями. К таким характеристикам в первую очередь относятся вольтамперные характеристики, ионные проводимости, отношения коэффициентов проницаемости для различных ионов.

Многообразие расчетных методов приводит к тому, что в работах, посвященных теоретическому исследованию ионного транспорта в каналах, часто встречается совпадение функциональных характеристик каналов, оцененных по (качественно и количественно) различным профилям иона одного и того же канала. Оно, как правило, является следствием физически не обоснованной калибровки энергетических профилей и параметров уравнений для расчета функциональных характеристик каналов.

Предварительно для расчета энергетических профилей мы использовали наиболее распространенные силовые поля молекулярной механики (AMBER, CHARMM, OPLS) и проводили их количественный анализ, применяя теорию переходного состояния для последующего сопоставления расчетных и экспериментальных результатов.

Свободная энергия Гиббса системы ион-вода-канал

, (1)

где, в квазистатическом приближении, – потенциальная энергия комплекса ион-канал, – эффективная диэлектрическая постоянная, зависящая от диаметра поры канала d, , и – потенциальная энергия комплекса вода-вода, вода-канал и ион-вода, соответственно, – энтропия.

Зависимость рассчитывали численным решением уравнения Буза (Conway,1981), величину – по полуэмпирическим формулам Лайо-Торрэ (Laio,Torre,1999), включающих экспериментальные значения свободной энергии Гиббса комплексов, содержащих i молекул воды и катион в газовой фазе.

Величину с хорошей степенью точности можно считать постоянной, не зависящей от локализации иона, для определенного канала. По результатам численного моделирования методом Монте-Карло установлено, что в зависимости от положения иона на оси канала принимает постоянное значение для определенного канала, при этом ошибка составляет не более 2%. Данный результат может быть обоснован статистической природой рассматриваемых взаимодействий и свойствами потенциалов межмолекулярного взаимодействия.

В методах силового поля представляется в виде суммы энергии кулоновского и вандерваальсового взаимодействия атомов канала и иона:

, (2)

где – кулоновский заряд i-го атома канала, – расстояние от i-го атома канала до иона, , – параметры вандерваальсового взаимодействия i-го атома и иона. Практически все традиционные силовые поля, применяемые в исследовании биомолекул, используют представление (2). Отличие наблюдается лишь в выражениях для параметров и . Силовые поля AMBER и CHARMM используют -параметризацию:

, , (3)

где , , , – параметры силового поля. Силовое поле OPLS традиционно использует -параметризацию:

, , (4)

где , , , – параметры силового поля. В случае потенциальной энергии взаимодействия двух одинаковых атомов или ионов параметр соответствует их вандерваальсову радиусу, – их равновесной энергии.

Важно отметить, что в подобных расчетах величины , , являются калибровочными параметрами, прежде всего по соображениям «равновесной геометрии» биомолекулярных систем. Поэтому нами исследована возможность замены параметра кристаллографическими и реальными ионными радиусами для возможного улучшения результатов.

В качестве тестируемого мембранного канала нами выбран потенциал-активируемый бактериальный калиевый канал KcsA из Streptomyces lividans. Данный выбор не является случайным, т.к. для данного канала существуют наиболее достоверные экспериментальные значения его функциональных характеристик. Канал KcsA является тетрамером. На рис. 1 представлен поперечный срез канала, демонстрирующий две из четырех его субъединиц. Пору канала можно условно разделить на три области: селективный фильтр, ответственный за ионную избирательность канала (I), относительно большую центральную полость (II) и нижнюю внутреннюю пору (III).

Профили ионов Cs+, Rb+, K+, Na+ и Li+, с рассчитанными методом силового поля AMBER , представлены на рис. 2.

Данные профили различаются во всех областях поры канала. Причем наиболее существенное различие энергетических профилей катионов наблюдается в области нижней поры канала. В нижней поре и в селективном фильтре канала KcsA существуют энергетические барьеры, причем их высоты для различных ионов находятся в следующей последовательности Cs+>Rb+>K+>Na+>Li+. В таком случае канал KcsA имеет расчетный ряд селективности Cs+<Rb+<K+<Na+<Li+, противоположный экспериментальному (Cs+<Rb+<K+>Na+>Li+)!

Аналогичные результаты были получены для профилей свободной энергии катионов, рассчитанных методом силового поля OPLS.

Таким образом, профили, рассчитанные методом силового поля, во-первых, не объясняют энергетическую предпочтительность дегидратации K+ по сравнению с другими ионами, а, во-вторых, не объясняют прохождение K+ через достаточно высокий энергетический барьер (28 ккал/моль) нижней поры канала.

Для получения количественных оценок функциональных характеристик канала использовали уравнения теории абсолютных скоростей реакций Эйринга. В таком случае профиль свободной энергии Гиббса канала может быть представлен в виде последовательности M энергетических барьеров, разделенных M-1 потенциальными ямами.

Вольтамперную характеристику (ВАХ) канала определяли по формуле

. (5)

Находя производную функции по переменной , определяли проводимость одиночного канала . Для объяснения ионной селективности мембранного канала мы использовали теорию Эйринга, которую количественно можно охарактеризовать как отношение проницаемостей для сравниваемых ионов А и В по формуле

, (6)

где М – масса иона. В зависимостях (5) и (6): () – константа скорости перехода из ямы i-1 в яму i (из ямы i в яму i-1), - вероятность того, что ион находится в i-й яме, – вероятность того, что канал не заполнен ионами. Константы скорости перехода определяли по формулам

,

,

где – значение энергии иона в i-м барьере (i-й яме), – электрическое расстояние между i-1 ямой и i-м барьером (между i-й ямой и i-м барьером), – частотный фактор.

Рассчитанные по формуле (5) ВАХ канала в условиях симметричных монокатионных растворов (М) представлены на рис. 3.

Расчет методом AMBER показывает существование линейной зависимости между током и напряжением на участке 0-60 мВ с величиной проводимости одиночного канала для K+ 0.016 пСм, для Na+ 1.3 пСм, для Li+ 0.68 пСм, для Rb+ 0.003 пСм, для Cs+ 0.001 пСм. Данные значения проводимостей находятся в разногласии с экспериментальными данными, согласно которым значение проводимости для различных типов калиевых каналов для K+ меняется от 4 до 270 пСм. Расчетные по формуле (6) значения отношений коэффициентов проницаемости для Li+, Na+, K+, Rb+ и Cs+ к коэффициенту проницаемости для K+ составляют 41.2, 83.1, 1, 0.2 и 0.07, соответственно. Данные значения не только противоречат экспериментальным данным (<0.09, <0.07, 1.00, 0.25-0.91 и <0.18), но и предсказывают существование селективного ряда, несвойственного калиевым каналам.

Таким образом, профили свободной энергии Гиббса, полученные методом силового поля, не только не позволяют дать количественное объяснение ионной избирательности канала, но и получить правильные качественные оценки его функциональных характеристик.

Данный вывод делает настоятельно необходимым разработать метод расчета профиля свободной энергии Гиббса, не требующий значительных затрат машинного времени и сохраняющий точность квантовохимического расчета. Этот метод может быть получен, если учесть, что специфические квантовомеханические эффекты, возникающие при расчете взаимодействия в системе ион-канал, существенны лишь на небольших расстояниях, т.е. там, где значимо перекрывание электронных оболочек иона и атомов молекул канала.

В таком случае потенциальную энергию системы ион-канал можно представить в виде , где – квантовомеханическая составляющая результирующей энергии, существенная при малых расстояниях ион – атомы канала, – классическая (кулоновская) составляющая, существенная при больших расстояниях ион – атомы канала.

Разделение взаимодействия на дальнее и ближнее может быть обосновано, если учесть, что гамильтониан двух взаимодействующих молекул (или иона и молекулы) имеет вид , где – сумма гамильтонианов изолированных молекул, – оператор их электростатического взаимодействия:

.

Здесь индексы, нумеруют ядра, индексы i, j – электроны молекул А и В соответственно.

Для вычисления электростатического взаимодействия молекул целесообразно использовать теорию возмущений. На далеких расстояниях между молекулами оператор можно рассматривать как малое возмущение. В первом приближении теории возмущений энергия электростатического взаимодействия определяется выражением .

Как правило, для практических расчетов межмолекулярных потенциалов требуются дальнейшие приближения. На больших расстояниях между взаимодействующими молекулами их электронные оболочки не перекрываются, и энергия электростатического взаимодействия с хорошей точностью может быть представлена в виде суммы нескольких первых членов разложения в ряд по степеням . С этой целью используется известное из электростатики мультипольное разложение потенциала в ряд Тейлора.

Если электронные оболочки взаимодействующих молекул перекрываются, то возникают силы дисперсионного и индукционного взаимодействия. Для описания данных сил необходим второй и более высокий порядок теории возмущений.

Энергию взаимодействия молекул во втором порядке теории возмущений можно представить в виде . Первое слагаемое данного выражения, энергия индукционного взаимодействия, соответствует электростатическому взаимодействию зарядов невозмущенной молекулы с электрическим полем, возникающим в результате деформации распределения заряда в другой молекуле. Второе слагаемое соответствует энергии дисперсионного взаимодействия. Дисперсионное взаимодействие не имеет классического аналога, как и индукционная энергия.

На малых расстояниях между взаимодействующими молекулами возникают обменные взаимодействия. Их проявление становится заметным на расстояниях менее , где – радиус Бора взаимодействующих атомов. На близких расстояниях, когда перекрывание электронных оболочек становится существенным, энергия отталкивания, обусловленная обменными взаимодействиями, вносит преобладающий вклад в общую энергию взаимодействующих молекул.

Энергию целесообразно рассчитывать одним из квантовохимических методов для системы ион – ближние к нему аминокислоты, энергию рассчитывать в приближении точечных зарядов на атомах дальних аминокислот по традиционной кулоновской схеме . Причем в качестве зарядов на атомах можно использовать параметры электростатических взаимодействий одного из силовых полей или точечные заряды на атомах, рассчитанные квантовохимически.

Наиболее простым в формальном отношении и одновременно дающим разумные результаты в некоторых случаях является метод Хоффмана или расширенный метод Хюккеля (EHT). Формально уравнения EHT представляются в виде:

, .

Матричные элементы заменяются эмпирическими параметрами или аппроксимируются специально подобранными соотношениями, включающими эти параметры. Так, диагональные матричные элементы полагаются равными потенциалам ионизации соответствующих валентных электронов, взятых с обратным знаком . Для вычисления недиагональных матричных элементов мы использовали параметризацию Вольфсберга-Гельмгольца , где К= 1.75.

Метод EHT дает адекватные результаты для молекулярных систем, имеющих равномерное распределение заряда по всем атомам или, иначе говоря, для молекул, атомы которых не сильно отличаются по электроотрицательности (обычно принимают различие не более 1.4 по шкале Полинга). Канал KcsA, как и многие другие каналы, формируется атомами C, O, N, S и H, электроотрицательности которых составляют 2.5, 3.6, 3.0, 2.5 и 2.1 соответственно, для катионов Li+, Na+, K+, Rb+ и Cs+ – 1.5, 3.3, 2.6, 2.4 и 1.8, соответственно (Бацанов,2000). Таким образом, максимальное значение для атомов канала KcsA составляет 1.5, причем только для не связанных ковалентными связями для Li+ и карбонильных кислородов, формирующих пору канала. Следовательно, применение квантовохимического метода Хоффмана для решения поставленных задач представляется вполне обоснованным.

Центральным вопросом расчетов по схеме является вопрос о расстоянии между ионом и атомами поры канала, на котором возможно данное разделение. Применительно к расчету энергии взаимодействия иона и молекулы канала, целесообразно провести такой расчет в приближении точечных зарядов на атомах отдельных аминокислот, а также квантовохимически в системе ион – соответствующая аминокислота. Вид и характер рассчитанных функций потенциальной энергии , где r – расстояние между ионом и аминокислотой, позволит определить координату точки их расхождения. Для определения координат точки разделения двух функций нами проведены квантовохимические и классические расчеты зависимости энергии взаимодействия от взаимного расстояния в системе ион–аминокислота. Подобные расчеты проведены для всех 20 аминокислот и 5 исследуемых ионов. Наши расчеты показывают, что в зависимости от выбора аминокислоты, координаты точки расхождения составляют 3.2–4.2. Таким образом, расстояние разделения взаимодействий должно быть не меньше 4.2. Для упрощения расчетов нами принято R=5.

Для расчета применяли параметры электростатических взаимодействий (заряды на атомах) силового поля AMBER. Данный выбор обусловлен тем, что результаты расчета методом AMBER хорошо сочетаются и согласуются с результатами квантовохимического расчета распределения потенциала в канале.

Профили свободной энергии Гиббса канала KcsA, рассчитанные методом EHT/AMBER, представлены на рис. 4.

Данные профили имеют качественно сходный вид для всех исследуемых ионов и соответствуют пятибарьерной модели канала. При этом наблюдается только количественное расхождение профилей. Величины энергетических барьеров ионов по абсолютной величине находятся в последовательности Li+>Na+>K+~>Rb+>Cs+. Учитывая, что последовательность энергетических барьеров ионов определяет последовательность ионных токов и рядов селективности, можно обоснованно прогнозировать согласие расчетных функциональных характеристик канала с экспериментальными.

Для проверки данного предположения нами проведен расчет функциональных характеристик канала по формулам (5) и (6), используя профиль, рассчитанный методом EHT/AMBER. Результаты расчета ВАХ канала в условиях симметричных монокатионных растворов (М) представлены на рис. 5.

Полученный результат показывает существование линейной зависимости между током и напряжением на участке 0-60 мВ, с величиной проводимости одиночного канала для K+ 26.34 пСм, для Na+ 1.72 пСм, для Li+ 0.24 пСм, для Rb+ 19.42 пСм, для Cs+ 0.03 пСм, что соответствует экспериментально получаемым значениям. Расчетные по формуле (7) значения отношений коэффициентов проницаемости для Li+, Na+, K+, Rb+ и Cs+ к коэффициенту проницаемости для K+ составляют 0.009, 0.065, 1.000, 0.737 и 0.001, соответственно, что хорошо согласуется с экспериментальными данными (<0.09, <0.07, 1.00, 0.25-0.91 и <0.18).

Во второй главе приведены результаты исследования функциональных характеристик потенциал-зависимых калиевых каналов по результатам анализа профилей свободной энергии, рассчитанных методом EHT/AMBER, решением уравнений теории абсолютных скоростей реакций Эйринга.

Движение ионов через биологические мембраны является одним из наиболее важных процессов, происходящих в живых клетках. Оно играет основополагающую роль в таких биофизических процессах, как преобразование энергии, поддержание постоянного химического состава внутренней среды, в регуляции метаболизма и биосинтеза, рецепции, сокращении мышц, генерации и распространении нервного импульса и др.

Центральной проблемой биофизики ионных каналов является установление связи между их структурой и функциями. Методами ядерного магнитного резонанса и рентгеноструктурного анализа установлены атомные структуры более ста макромолекул, которые можно отнести к классу мембранных каналов.

Исследование механизмов функционирования всего многообразия мембранных каналов является, несомненно, более сложной задачей, чем установление их структуры. Это связано с большими материальными затратами на экспериментальные исследования и огромными временными затратами для теоретических исследований.

К потенциал-зависимым калиевым каналам клетки относятся каналы, специфически активируемые деполяризацией клеточной мембраны и ассоциированные с мембранной реполяризацией. Калиевые каналы играют важную роль в процессах возбудимости и проводимости мембран. Практически все каналы суперсемейства потенциал-зависимых калиевых каналов являются аксиально-симметричными белковыми порами, что дает возможность использовать разработанный и апробированный на канале KcsA алгоритм расчета функциональных характеристик каналов.

Потенциал-зависимый калиевый канал KvAP содержит стандартную K+-пору, окруженную сенсорами напряжения. Сенсоры напряжения могут менять конфигурацию за счет изменения разности потенциалов на концах мембраны и открывать пору. Они локализованы около внутриклеточной поверхности канала.

Исследовательской группой Р. Маккинона (2003) определена атомная структура калиевого канала и было высказано предположение о том, что KvAP в зависимости от направления мембранного потенциала, определяющего положение сенсора в пространстве, может находиться в двух конформациях: открытой – пропускающей ионы, и закрытой – не пропускающей ионы. При изменении разности потенциалов на концах мембраны подвижный сенсор напряжения занимает новое положение, что приводит к переходу канала из открытого состояния в закрытое, и наоборот. Модель Р. Маккинона объясняет переход канала из одного состояния в другое, но не дает ответа на вопрос о механизмах калиевой избирательности открытого и отсутствия таковой для закрытого канала KvAP.

Нами проведено теоретическое исследование функциональных характеристик открытого и закрытого канала KvAP. Результаты расчета профилей свободной энергии для ионов Li+, Na+, K+, Rb+, Cs+ в поре открытого и закрытого канала представлены на рис. 7 и 8, соответственно. Профили в области селективного фильтра и центральной полости открытого и закрытого аналогичны профилям энергии в соответствующих областях потенциал-независимого калиевого канала KcsA, что является следствием гомологичности каналов KvAP и KcsA. Существенное отличие каналов KvAP и KcsA наблюдается только в области нижней поры, что обусловлено наличием дополнительных сенсоров напряжения в канале KvAP. В данной области открытого и закрытого канала KvAP появляются энергетические барьеры для всех видов ионов. Причем в закрытом канале значения энергетических барьеров больше, чем в открытом и в закрытом канале KvAP, а величина диаметра закрытого канала в области нижней поры меньше, чем открытого. Это различие приводит к увеличению стерических ограничений для ион-водного комплекса и, как следствие, к увеличению значения энергии данного комплекса в закрытом канале.

Таким образом, появление больших, по сравнению с открытым каналом, энергетических барьеров в области нижней поры закрытого канала KvAP может быть причиной наблюдаемого отсутствия ионной проводимости канала.

Для количественного обоснования данного утверждения нами проведен анализ полученных профилей решением уравнений (5) и (6). Результаты расчета ВАХ для открытого и закрытого одиночного канала KvAP в условиях симметричных монокатионных растворов (М) представлены на рис. 9 и 10, соответственно. Данные связи показывают существование линейной зависимости между током и напряжением на участке 0–60 мВ с величиной проводимости одиночного открытого канала для K+ 12.93 пСм, для Na+ 0.32 пСм, для Li+ 0.13 пСм, для Rb+ 9.6 пСм, для Cs+ 0.083 пСм, что соответствует экспериментально получаемым значениям. Проводимости закрытого канала для K+, Na+, Li+, Rb+ и Cs+ принимают значения 0.10 пСм, 0.007 пСм, 0.002 пСм, 0.066 пСм и 0.001 пСм, соответственно.

Таким образом, появление значительного энергетического барьера в канале KvAP при переходе его из открытого состояния в закрытое при изменении разности потенциалов на концах мембраны является причиной появления малых ионных токов, характерных для закрытого ионного канала.

Расчетные значения отношений коэффициентов проницаемости для Li+, Na+, K+, Rb+ и Cs+ к коэффициенту проницаемости для K+ составляют 0.010, 0.024, 1.000, 0.701 и 0.006, соответственно, что хорошо согласуется с экспериментальными данными.

Потенциал-зависимые калиевые каналы обычно экспрессируются вместе с дополнительными -субъединицами. В работах группы Р. Маккинона была определена с разрешением 2.8 структура -субъединицы калиевого канала. При этом структура -субъединицы канала определена не была.

При построении структуры потенциал-зависимого калиевого канала в виде комплекса - и -субъединиц (/-канал) мы исходили из совпадения осей аксиальной симметрии - и -субъединицы. При этом -субъединица стыкуется с вогнутой поверхностью -субъединицы (Рис. 11). В качестве -субъединицы мы использовали аксиально-симметричный тетрамер потенциал-независимого калиевого канала KcsA, как каноническую пороформирующую субъединицу трансмембранных калиевых каналов клетки.

Результаты расчета профилей открытого канала для ионов Li+, Na+, K+, Rb+, Cs+ представлены на рис. 12. Для наглядности профили свободной энергии потенциал-зависимого калиевого /-канала представлены для трех последовательных интервалов изменения координаты оси Z: области селективного фильтра и центральной полости -субъединицы (рис. 12А), области нижней поры -субъединицы и поры -субъединицы (рис. 12Б).

Анализ энергетического профиля показывает, что основными факторами, влияющими на характер транспорта иона через канал, являются: частичная дегидратация иона при входе в пору канала и взаимодействие иона с атомными группами канала. Повышение энергии иона в результате дегидратации оказывается наибольшим у иона Li+ и наименьшим у иона K+, что обусловлено наибольшими размерами последнего, а значит, меньшими (по модулю) величинами его взаимодействия с молекулами воды в первой гидратной оболочке.

Результаты расчета ВАХ для /-канала в условиях симметричных монокатионных растворов (М) представлены на рис. 13. Данная связь показывает существование линейной зависимости между током и напряжением на участке 0-60 мВ с величиной проводимости одиночного канала для K+ 17.16 пСм, для Na+ 0.68 пСм, для Li+ 0.26 пСм, для Rb+ 16.63 пСм, для Cs+ 0.08 пСм, что соответствует экспериментально получаемым значениям. Проводимость /-канала для ионов калия несколько меньше, чем проводимость канала KcsA для соответствующих ионов, что является следствием наличия дополнительной -субъединицы в /-канале. Для ионов лития и натрия наблюдается незначительное расхождение в значениях проводимости каналов / и KcsA. Расчетные значения отношений коэффициентов проницаемости для Li+, Na+, K+, Rb+ и Cs+ к коэффициенту проницаемости для K+ составляют 0.079, 0.015, 1.000, 0.905 и 0.005, соответственно, что хорошо согласуется с экспериментальными данными.

Таким образом, модельная молекулярная структура в виде комплекса - и -субъединиц может служить адекватной моделью потенциал-зависимого калиевого /-канала в открытом состоянии.

Для построения модели потенциал-зависимого калиевого /-канала в закрытом состоянии мы исходили из следующих предположений (рис. 11):

1) потенциал-зависимый калиевый /-канал представляет собой потенциал-зависимый фермент с активными участками в -субъединице, локализованными на расстоянии 30-35 от оси канала и содержащие NADP+-кофакторы;

2) при связывании фермента с молекулой субстрата происходят конформационные изменения в -субъединице, что в свою очередь приводит к конформационным изменениям в -субъединице.

Изменение конформации канала за счет связывания с молекулой субстрата может быть причиной формирования закрытого для ионов /-канала. При этом возможны два не исключающих друг друга случая: «разбухание» молекулы канала и поворот отдельных полярных субъединиц в составе -субъединицы при изменении разности потенциалов на концах мембраны, что приводит к изменению положения отдельных субъединиц -субъединицы. Учитывая, что экспериментальные данные по структуре субстрата отсутствуют, нами проведено исследование зависимости ионной проводимости от диаметра /-канала. Мы исследовали зависимость , где – отношение диаметра открытого канала к диаметру конформационно модифицированного канала с шагом 0.1.

Для расчета ионных токов, отношений коэффициентов проницаемости и проводимости канала мы использовали подход, который применяли для исследования открытого /-канала. При этом предполагали, что вследствие малости молекулы субстрата, его поле дает пренебрежимо малый вклад в энергетические профили.

В результате проведенных расчетов установлено, что при , т.е. уменьшении диаметра почти в 2 раза, наблюдается достаточно малое значение тока ионов калия через канал: пА. В табл. 1 представлены значения ионных токов при различных значениях .

Таблица 1

Ионные токи () при различных значениях отношений () диаметров открытого и конформационно модифицированного потенциал-зависимого калиевого /-канала

1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8
, пА 0.016 0.014 0.012 0.010 0.008 0.006 0.004 0.002 0.001
, пА 0.081 0.072 0.063 0.054 0.045 0.036 0.027 0.017 0.012
, пА 1.030 0.810 0.690 0.570 0.450 0.330 0.210 0.090 0.076

Для объяснения причин падения калиевого тока практически до значений, соизмеримых с натриевым током канала, обратимся к профилям свободной энергии канала, представленных, как и в случае открытого канала, для трех последовательных интервалов изменения координаты оси Z: области селективного фильтра и центральной полости -субъединицы (рис. 14A), области нижней поры -субъединицы и поры -субъединицы (рис. 14Б).

Существенное различие открытого и закрытого канала наблюдается только в области сужения поры -субъединицы. При этом высоты барьеров для различных ионов находятся в следующей последовательности K+<Na+<Li+. Появление столь высоких энергетических барьеров в закрытом канале связано не с увеличением энергии взаимодействия в системе ион-канал, а с увеличением энергии взаимодействия в системе ион-вода в результате стерических ограничений ион-водного комплекса. Действительно, увеличение стерических ограничений для ион-водного комплекса приводит к уменьшению количества молекул воды в частично дегидратированном комплексе и увеличению энергии ион-водного комплекса.

Результаты расчета ВАХ закрытого потенциал-зависимого калиевого /-канала в условиях симметричных монокатионных растворов (М) представлены на рис. 15. Данная связь показывает существование линейной зависимости между током и напряжением на участке 0–60 мВ с малыми величинами проводимости одиночного канала: для K+ 1.27 пСм, для Na+ 0.20 пСм, для Li+ 0.016 пСм, для Rb+ 1.05 пСм, для Cs+ 0.005 пСм, что соответствует закрытому состоянию потенциал-зависимого калиевого канала.

Таким образом, переход потенциал-зависимого калиевого /-канала из открытого в закрытое состояние осуществляется при связывании молекулы субстрата с -субъединицей канала, сопровождающийся конформационной перестройкой канала при изменении разности потенциалов на концах мембраны.

В результате предложенная и теоретически обоснованная нами модельная структура /-канала хорошо согласуется с экспериментально наблюдаемой структурой гомологичного канала Kv 1.2.

Подобный подход мы использовали и для исследования потенциал-зависимого калиевого канала Kv1.2 типа Shaker из Rattus norvegicus, для которого получили хорошее согласие экспериментальных и расчетных функциональных характеристик.

В третьей главе проведено исследование структуры и функциональных характеристик хирально модифицированных модельных каналов без изменения их природной первичной структуры. Также рассмотрено влияние изомеризации Asn, обусловленное in vivo биологическим старением или различными заболеваниями, на структуру и функциональные характеристики каналов.

Долгое время считалось, что хиральная чистота биосферы носит абсолютный характер, т.е. биологически важные реакции в живых организмах происходят только с участием L-аминокислот и D-сахаров.

Однако хиральные антиподы природных органических соединений играют существенную роль в биохимии и физиологии всех организмов - от бактерий до млекопитающих. Например, D-Ser является нейромодулятором, связывающимся с активным сайтом NMDA-рецептора нервных клеток у млекопитающих. Компоненты клеточной стенки бактерий зачастую содержат L-углеводы и остатки D-аминокислот. Данные остатки также содержат некоторые пептидные антибиотики. В нервных клетках высших организмов находят D-Ala, D-Asp и D-Ser, в некоторых случаях в значительных концентрациях. Однако все, что относится к рибосомальному синтезу полипептидов, характеризуется абсолютной хиральной чистотой: полипептиды содержат остатки только L-аминокислот, а нуклеиновые кислоты – только D-сахара.

Вопрос о биологической роли гомохиральности этих важнейших биополимеров решается просто. Так, гомохиральность белков и нуклеиновых кислот определяет их стереоспецифичность – необходимое условие матричного синтеза, а также обусловливает стабильность их структур, обеспечивающих их функционирование. Но, несмотря на значительные успехи, достигнутые в этой области, биологические основы того, что белки-ферменты и нуклеиновые кислоты имеют строго определенный знак хиральности, остаются неизвестными.

Нам представляется, что ответ на последний вопрос необходимо искать, в частности, в исследовании влияния изомеризации аминокислотных остатков на структурно-функциональные свойства ионных каналов.

Возможны два способа построения пространственной структуры каналов из D-аминокислот.

1. Построение модельного канала полным зеркальным отражением природного канала. В этом случае получаем канал из D-аминокислот с преобразованием торсионных углов всех аминокислот вида - и -. Следствием этого будет, например, преобразование всех правых -спиралей в левые. Не вызывает сомнений, что «отраженный» канал ни чем, кроме направления вращения -спиралей и направления скрученности -структур из-за скрученности отдельных -тяжей, не будет отличаться от природного. Неизменной будет и потенциальная энергия молекулы канала и его функциональные характеристики. Поэтому построение и исследование функционирования таких хирально модифицированных каналов не представляет интереса.

2. Построение модельного канала заменой всех L-аминокислот на D-аминокислоты при сохранении природной вторичной структуры канала. Такая замена эквивалентна замене бокового радикала R на H-атом, стоящий при -углероде аминокислоты. В результате, при сохранении природной вторичной структуры в молекуле модельного канала появляются значительные стерические напряжения, снятие которых приведет к изменению его третичной и четвертичной структуры, а также функциональных характеристик. Поэтому хирально модифицированные каналы, полученные по данной схеме, представляют наибольший интерес в исследовании их структуры и функциональных характеристик. Следует отметить, что появление стерических напряжений является вполне обоснованным, т.к. углы и модифицированных аминокислот в основном попадают в запрещенные области карты Рамачандрана.

Стерические напряжения в канале снимали методами молекулярной динамики в интервале 10 пс при шаге 0.001 пс. При расчете функции потенциальной энергии молекулы мы использовали представление и параметризацию силового поля AMBER. Данный выбор обоснован тем, что силовое поле AMBER было параметризовано для исследования структуры и динамики белков и нуклеиновых кислот. Для исследования функциональных характеристик хирально модифицированных модельных каналов использовали подход, применявшийся нами для исследования природных калиевых каналов.

Результаты численного моделирования молекулярной динамики каналов показывают, что зависимости потенциальной энергии молекулы канала от времени характеризуются наличием множества локальных минимумов, причем по нашим наблюдениям, каждый из них соответствует пору-формирующей конформации молекулы как природного, так и хирально модифицированного канала.

В табл. 2 представлены результаты исследований структуры и функциональных характеристик хирально модифицированных модельных каналов: отношение наиболее глубокого локального минимума природного канала к соответствующему минимуму его хирально модифицированного изомера (), отношение среднего радиуса поры D-аминокислотного канала (D-канала) к радиусу поры его природного аналога (), ионные проводимости (, пСм) и токи (, пА) D-канала при =60мВ.

Таблица 2

Канал
D-KcsA 0.99 1.4 Li+ 18.533 Li+ 0.015
Na+ 146.366 Na+ 0.103
K+ 459.700 K+ 1.580
Rb+ 401.883 Rb+ 1.165
Cs+ 3.850 Cs+ 0.002
D-KvAPo 1.01 1.2 Li+ 3.683 Li+ 0.221
Na+ 31.267 Na+ 1.876
K+ 405.305 K+ 24.321
Rb+ 318.900 Rb+ 19.134
Cs+ 3.483 Cs+ 0.209
D-KvAPc 1.01 1.2 Li+ 0.216 Li+ 0.013
Na+ 0.866 Na+ 0.052
K+ 12.850 K+ 0.771
Rb+ 5.766 Rb+ 0.346
Cs+ 0.716 Cs+ 0.043
D-/o 1.012 1.05 Li+ 2.717 Li+ 0.163
Na+ 7.200 Na+ 0.432
K+ 174.267 K+ 10.456
Rb+ 164.083 Rb+ 9.845
Cs+ 2.533 Cs+ 0.152
D-/c 1.011 1.05 Li+ 0.383 Li+ 0.023
Na+ 2.600 Na+ 0.156
K+ 13.900 K+ 0.834
Rb+ 12.800 Rb+ 0.768
Cs+ 0.150 Cs+ 0.009
D-Kv1.2o 1.001 1.07 Li+ 2.717 Li+ 0.101
Na+ 5.667 Na+ 0.340
K+ 99.783 K+ 5.987
Rb+ 79.083 Rb+ 4.745
Cs+ 1.583 Cs+ 0.095
D-Kv1.2c 1.002 1.07 Li+ 2.717 Li+ 0.091
Na+ 5.667 Na+ 0.095
K+ 99.783 K+ 0.097
Rb+ 79.083 Rb+ 0.088
Cs+ 1.583 Cs+ 0.076

Представленные в табл. 2 теоретические результаты наглядно демонстрируют, что полная потенциальная энергия хирально модифицированных и соответствующих природных каналов совпадает, а изомеризация аминокислот каналов приводит к увеличению радиуса поры. Кроме того, хирально модифицированный изомер канала KcsA не является калий-избирательным с большими значениями ионных токов, что характерно и для открытых D-каналов KvAP, / и Kv1.2. Хирально модифицированные изомеры закрытых каналов KvAP, / и Kv1.2 обладают проводимостями и токами, практически совпадающими с таковыми для их природных изомеров. Этот результат позволяет считать, что хирально модифицированные изомеры закрытых потенциал-зависимых каналов на самом деле является не закрытыми, а открытыми потенциал-зависимыми калиевыми каналами.

Подобные же исследования нами проведены для NR1 активного центра NMDA-рецептора в комплексе с Gly, D-Ser и D-cSer. В результате численного моделирования молекулярной динамики было установлено, что комплекс природного NR1 активного центра NMDA-рецептора и природных D-лигандов энергетически более стабилен, чем комплекс природного NR1 активного центра NMDA-рецептора и неприродных L-лигандов. Напротив, комплекс хирально модифицированного NR1 активного центра NMDA-рецептора и неприродных L-лигандов энергетически почти эквивалентен комплексу природного NR1 активного центра NMDA-рецептора и природного D- лиганда.

Возможно, эта функциональная, а не энергетическая неэквивалентность стереоизомеров пептидов могла играть важную роль в возникновении гомохиральности строго определенного знака белков на уровне отбора наиболее совершенных структур в ходе эволюции.

Вплоть до 70-х годов прошлого века считалось, что все белки живых организмов состоят из L-аминокислот. Однако экспериментально было установлено, что в процессе старения наблюдается увеличение содержания D-аминокислот в различных тканях организма человека и животных в результате неферментативной рацемизации аминокислот (НРА) белков. Причем из двадцати аминокислот Asn и Asp в белках являются структурно нестабильными и наиболее подверженными неферментативной рацемизации. Отмечено появление D-Asp и D-Asn в белках больных болезнью Альцгеймера, Паркинсона, при склеротических изменениях в сердечно-сосудистой системе, при глазной катаракте и т.д. Вероятно, аккумуляция D-аминокислот в белках приводит к изменению их пространственной структуры и нарушению функциональных свойств.

Учитывая, что время рацемизации Asn в белках не превышает времени жизни ионных каналов, представляет интерес исследование структуры и механизмов функционирования белков ионных каналов, в которых проведена модельная рацемизация аминокислот вида L-Asn D-Asn.

Важность исследования влияния НРА на структуру и функциональные характеристики ионных каналов обусловлена несколькими причинами. Во-первых, экспериментально установлены (Погорелов и др., 2006) возрастные изменения содержания основных клеточных катионов калия и натрия в мышечной клетке сердца и генетически обусловленные возрастные изменения в структуре калиевых каналов, следствиями которых является усиление НРА каналов. Во-вторых, отмечается, что патогенез болезней характерных для людей пожилого возраста связан с НРА белков, вовлеченных в патофизиологические процессы при данных заболеваниях. Так, существуют данные о вовлечении NMDA-рецепторов в патофизиологические процессы при указанных хронических заболеваниях мозга.

Результаты наших расчетов показали, что в ходе старения может уменьшаться (в среднем в 1.2 раза) энергетическая стабильность ионных каналов. При этом если разность значений энергии соответствующих открытых и закрытых потенциал-зависимых каналов «молодого организма» может компенсироваться изменением разности потенциалов на концах мембраны, то для потенциал-зависимых калиевых каналов «старого организма» такие компенсации весьма затруднительны. Соответствующие разности энергий ионных каналов «старого организма» составляют: 32.01 ккал/моль для KvAP-канала, 31.85 ккал/моль для /-канала и 53.59 ккал/моль для Kv1.2-канала. Вполне возможно, данный результат указывает на то, что изменения знака разности потенциалов на концах мембраны или недостаточно для перехода потенциал-зависимых калиевых каналов из открытого состояния в закрытое или требуют большего времени для такого перехода.

Численным моделированием молекулярной динамики нами установлено, что для NMDA-рецептора следствием НРА является незначительное увеличение стабильности комплекса его активного центра и лигандов нативного рецептора: Gly, D-Ser, D-Asn и D-Thr. Кроме того, нами установлено, что алифатические неполярные аминокислоты D-Ala, D-Leu, D-Ile и D-Pro являются лигандами NR1 активного центра с НРА NMDA-рецептора в патологии, обусловленной болезнями пожилого возраста.

Для каналов с D-Asn с величинами проводимостей, незначительно отличающимися от проводимостей ионных каналов молодого организма, наблюдается существование линейной зависимости между током и напряжением на участке 0-60 мВ. Для канала KcsA с D-Asn проводимости для Li+, Na+, K+, Rb+ и Cs+ составляют 0.16 пСм, 2.42 пСм, 33.15 пСм, 31.41 пСм и 0.20 пСм, соответственно; для D-Asn-KvAP-канала – 0.16 пСм, 0.41 пСм, 20.56 пСм, 16.98 пСм и 0.15 пСм; для D-Asn-/-канала – 0.30 пСм, 0.93 пСм, 24.26 пСм, 18.85 пСм и 0.13 пСм; для D-Asn-Kv1.2-канала – 0.48 пСм, 1.58 пСм, 31.60 пСм, 24.21 пСм и 0.38 пСм. Для всех исследованных каналов с D-Asn наблюдается незначительное (порядка 0.1пА) увеличение ионных токов, при этом отношения коэффициентов проницаемостей практически не меняются.

Таким образом, в результате старения организма может происходить увеличение ионных токов потенциал-зависимых калиевых каналов мембраны при сохранении свойства их калиевой избирательности.

В четвертой главе рассмотрена структура, механизмы функционирования и особенности гипотетического матричного синтеза хирально модифицированных каналов с отличной от природной первичной структурой.

Изомеризация всех L-аминокислот природного канала при сохранении природной первичной и вторичной структуры приводит к изменению основных функциональных характеристик и потери его калиевой избирательности. Такие результаты делают настоятельно необходимым рассмотреть возможность изменения природной первичной структуры каналов до получения третичной структуры хирально модифицированного модельного канала с природными функциональными характеристиками.

Для построения хирально модифицированных модельных каналов с природными функциональными характеристиками нами предложен метод «энергетического выравнивания» третичных структур каналов с различными аминокислотными последовательностями.

Метод включает следующую последовательность действий:

1) для третичной структуры природного канала рассчитываются энергии взаимодействия каждой аминокислоты с остальными аминокислотами и строится распределение энергии взаимодействия всех L-аминокислот канала;

2) подобное распределение энергии аминокислот рассчитывается для соответствующего хирально модифицированного модельного канала с природной первичной структурой без оптимизации его геометрии;

3) сравнением полученных распределений энергии L- и D-аминокислот, определяются D-аминокислоты, для которых разность соответствующих энергий принимает наибольшие значение;

4) наиболее напряженные D-аминокислоты заменяют D-аминокислотами, для которых разность энергий взаимодействия будет минимальной;

5) в полученном хирально модифицированном канале с модифицированной первичной структурой методами молекулярной динамики снимают остаточные стерические напряжения.

Замену L- на D-аминокислоты проводили исключительно в пределах родственных групп аминокислот.

В результате энергетического выравнивания получается хирально модифицированный модельный канал энергия, геометрия поры, энергетические профили и функциональные характеристики которого пренебрежимо мало отличаются от таковых соответствующего природного канала.

Распределение абсолютных значений разности энергий аминокислотных остатков природного канала KcsA и неоптимизированного его хирально модифицированного изомера представлено на рис. 16. Диаграмма показывает, что в некоторых аминокислотных остатках существуют значительные стерические напряжения, достигающие 88000 ккал/моль. Очевидно, что данное значение энергии, как и многие другие значения энергии D-аминокислот, значительно превышает среднее значение энергии пептидной связи, что определяет принципиальную невозможность существования такого полипептида и использования энергетического выравнивания для снятия значительных стерических напряжений в полипептиде.

Диаграмма представленная на рис. 17 показывает распределение абсолютных значений разности энергий L-аминокислотных остатков природного и хирально модифицированного модельного канала с модифицированной аминокислотной последовательностью, полученной энергетическим выравниванием структур. В этом случае замена значительно напряженных аминокислотных остатков в неоптимизированном хирально модифицированном изомере приводит к появлению ненапряженной, по сравнению с природной структурой, третичной структуры хирально модифицированного канала KcsA. Ниже представлена аминокислотная последовательность хирально модифицированного

AATGRGGGAGSVIGAAGAGAGCGGAGIADGGAVGADVASSAKGAHHAGASASSAGYGDGASGSIHGHCVGVVAGAAGISSVGAVSAAGASHFVGREQ

и природного канала KcsA.

ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQ

Подобный подход нами использовался для построения молекулярных структур хирально модифицированных изомеров каналов KvAP, /, Kv1.2 и NR1 активного центра NMDA-рецептора. В табл. 3 представлены результаты исследований структуры и функциональных характеристик, полученных энергетическим выравниванием хирально модифицированных каналов.

Таблица 3

Канал
D-KcsA 0.857 1.07 Li+ 0.23 Li+ 0.015
Na+ 1.65 Na+ 0.103
K+ 26.37 K+ 1.580
Rb+ 18.88 Rb+ 1.165
Cs+ 0.02 Cs+ 0.002
D-KvAPo 0.923 1.05 Li+ 0.083 Li+ 0.005
Na+ 0.035 Na+ 0.021
K+ 11.68 K+ 0.701
Rb+ 10.03 Rb+ 0.602
Cs+ 0.15 Cs+ 0.009
D-KvAPc 0.934 1.04 Li+ 0.005 Li+ 0.0003
Na+ 0.003 Na+ 0.0002
K+ 0.093 K+ 0.0056
Rb+ 0.065 Rb+ 0.0039
Cs+ 0.002 Cs+ 0.00012
D-/o 0.871 1.02 Li+ 0.005 Li+ 0.012
Na+ 0.53 Na+ 0.039
K+ 1.1 K+ 1.029
Rb+ 0.98 Rb+ 1.001
Cs+ 0.01 Cs+ 0.009
D-/c 0.869 1.02 Li+ 0.05 Li+ 0.003
Na+ 0.053 Na+ 0.032
K+ 1.1 K+ 0.066
Rb+ 0.98 Rb+ 0.059
Cs+ 0.012 Cs+ 0.0007
D-Kv1.2o 0.901 1.01 Li+ 0.32 Li+ 0.019
Na+ 0.56 Na+ 0.034
K+ 10.75 K+ 0.645
Rb+ 6.63 Rb+ 0.398
Cs+ 0.02 Cs+ 0.001
D-Kv1.2c 0.889 1.01 Li+ 0.002 Li+ 0.0001
Na+ 0.02 Na+ 0.001
K+ 0.06 K+ 0.0035
Rb+ 0.03 Rb+ 0.0018
Cs+ 0.002 Cs+ 0.0001

Представленные в табл. 3 результаты позволяют утверждать, что радиус поры и функциональные характеристики хирально модифицированных каналов практически совпадают с таковыми для соответствующих природных каналов. При этом хирально модифицированные каналы энергетически более стабильны, чем соответствующие природные каналы (хирально модифицированные каналы примерно в 1.2 раз энергетически более стабильны, чем существующие природные каналы).

В отличие от калиевых каналов, в результате подобных исследований структуры хирально модифицированного NR1 активного центра NMDA-рецептора нами установлено, что комплекс природного NR1 активного центра NMDA-рецептора и природных D-лигандов энергетически более стабилен, чем комплекс хирально модифицированного NR1 активного центра NMDA-рецептора и неприродных L-изомеров лиганда. Так для лигандов Gly, Ser и cSer разность энергий комплексов составляет 134.18 ккал/моль, 148.29 ккал/моль и 145.04 ккал/моль, соответственно.

Молекулярный комплекс хирально модифицированного NR1 активного центра NMDA-рецептора и природных D-лигандов энергетически менее стабилен, чем комплекс природного NR1 активного центра NMDA-рецептора и природного D-изомера лиганда. Для лигандов Gly, Ser и cSer разность энергий комплексов составляет 1457.05 ккал/моль, 1443.05 ккал/моль и 1447.99 ккал/моль, соответственно. Данный результат существенно отличается от результата, полученного для хирально модифицированных калиевых каналов с модельной первичной структурой. Нам представляется вполне очевидным, что для получения значения энергии комплекса хирально модифицированного активного центра NMDA-рецептора с L-лигандом согласующейся с энергией комплекса природного активного центра NMDA-рецептора и природного лиганда, необходимо, кроме модификации первичной структуры рецептора, использование другого лиганда. Данное обстоятельство обусловлено тем, что, в отличие от иона, лиганд активного центра NMDA-рецептора является более сложной (многоцентровой) молекулярной структурой.

Последний результат, возможно, означает, что в «зеркальном мире» совершенно другими были бы клеточные рецепторы и их субстраты. Следовательно, совершенно другой была бы и вся биохимия клеточных процессов, связанных с рецепцией.

Для исключения возможных артефактов метода энергетического выравнивания нами проверены коммутативность операций зеркального отражения и минимизации полной энергии молекулы. Проведено решение обратной задачи построения методом энергетического выравнивания структуры природного канала из структуры хирально модифицированного модельного канала с природными функциональными характеристиками. В результате функциональные характеристики модельного и природного канала достаточно хорошо согласуются друг с другом (абсолютная ошибка составляет не более 3%), а метод энергетического выравнивания можно считать надежным методом построения хирально модифицированных каналов с природными функциональными характеристиками.

Подобная коммутативность нами проверена также для грамицидинового канала – одного из наиболее хорошо изученных каналов, сформированным пептидным антибиотиком грамицидином А. Грамицидин синтезируется в ходе S-матричного синтеза, который широко распространен у бактерий. При Sматричном синтезе пептидов, возникшем на гораздо более поздних стадиях эволюции, чем синтез рибосомальный, могут использоваться нестандартные аминокислоты, в том числе и Dаминокислоты. В результате проведенного расчета установлено, что расхождение отношений коэффициентов проницаемостей хирально модифицированного и природного грамицидинового канала составляет не более 2%, что подтверждает выполнение коммутативности рассмотренных операций.

Нам представляется, что в ходе предбиологической эволюции могли сформироваться белки, построенные из D-аминокислот, но с первичной структурой, отличной от существующей природной структуры белков. Не вызывает сомнений, что в этом случае для обеспечения матричного синтеза D-белков нуклеиновые кислоты будут построены из L-сахаров. Следует отметить, что существование биосферы, которая использует D-аминокислоты и L-сахара, согласуется с выводами традиционной теории спонтанного нарушения зеркальной симметрии и существуют достоверные данные о взаимодействии аминокислот и нуклеиновых кислот различной хиральности.

Возможно, одной из отличительных особенностей матричного синтеза белков, построенных из D-аминокислот, является изменение нуклеотидной последовательности гена, кодирующего D-аминокислотную последовательность белка.

Если сохранение нуклеотидной последовательности гена, кодирующего аминокислотную последовательность природного белка, является необходимым условием, то теоретически возможен и другой способ изменения аминокислотной последовательности белка. Это изменение может быть следствием изменения формальной структуры генетического кода. Так, если сравнить D-аминокислотные последовательности модельных каналов, сохранивших природную функциональность, то несложно установить варианты преобразований L-аминокислот в D-аминокислоты. Причем это единственная схема преобразований, позволяющая получать хирально модифицированные модельные каналы с природной функциональностью. Данное преобразование представлено на рис. 18.

Наиболее вероятно, что для синтеза наиболее ранних белков потребовалось 10 D-аминокислот (G, A, S, C, D, N, K, H, F, P) и, соответственно, вполне достаточной была бы дублетная таблица D-аминокислотного генетического кода, кодирующая не более 15 аминокислот. Нам представляется, что именно ионные каналы как молекулярные посредники формирования ионной асимметрии клеток – необходимого условия их стабильности, возможно, являются наиболее ранними белками.

Двукратное уменьшение аминокислот в генетическом коде приведет к сокращению в 2N раз (N – количество аминокислотных остатков в белке) количества различных вариантов D-аминокислотной последовательности белка и существенному уменьшению разнообразия структур и функций белков зеркальной клетки.

На более поздних этапах эволюции D-аминокислотных белков, в процессе увеличения разнообразия структур и функций белков, в матричный синтез могли бы быть включены другие D-аминокислоты, что привело бы к усложнению генетического кода до триплетного и увеличению разнообразия структур и функций белков.

Вопрос о возможном эволюционном возникновении большего разнообразия используемых в биосинтезе аминокислот может быть решен на основе теории коэволюции (Wong,1975). При этом полный анализ взаимодействия факторов эволюции, которое могло бы привести к переходу на триплетный код и к использованию набора из 20 D-аминокислот в рибосомальном синтезе белков, выходит за рамки настоящей работы.

ВЫВОДЫ

1) Разработанный и теоретически реализованный метод расчета комбинированных энергетических профилей ионов в каналах, основанный на разделении и независимом квантовохимическом расчете ближних и молекулярно-механическом расчете дальних взаимодействий, позволил получить хорошее согласие теоретических и экспериментальных значений функциональных характеристик каналов и определить значения функциональных характеристик ранее не исследованных хирально модифицированных каналов.

2) Хирально модифицированные модельные каналы с природной первичной структурой имеют относительно большой диаметр поры канала и не являются калий-избирательными каналами, пропуская с разными проводимостями все катионы, при этом их полная потенциальная энергия совпадает с энергией соответствующих природных каналов.

3) В результате рацемизаций Asn в белках, обусловленных старением организма, наблюдается уменьшение энергетической стабильности калиевых каналов и незначительное увеличение стабильности комплекса NR1 активного центра NMDA-рецептора с лигандами, а также незначительное увеличение ионных токов калиевых каналов, при сохранении их калиевой избирательности и уменьшении времени перехода каналов из открытого состояния в закрытое.

4) Разработанный и теоретически реализованный метод построения хирально модифицированных каналов с природными функциональными характеристиками, основанный на энергетическом выравнивании третичных структур каналов с различными аминокислотными последовательностями, позволил получить молекулярные структуры хирально модифицированных каналов с функциональными характеристиками соответствующих природных каналов. При этом модельные каналы энергетически более стабильны, чем соответствующие природные каналы.

5) Для получения первичной структуры белка, построенного из D-аминокислот, с природной функциональностью достаточно 10 D-аминокислот. Следовательно, в «зеркальном мире» таблица генетического кода могла бы состоять из 10 D-аминокислот и если предполагать, что ДНК будет составлена из четырех оснований, то в данном случае достаточным будет дублетный код, кодирующий не более 15 аминокислот. При этом на более поздних этапах эволюции D-аминокислотных белков, в процессе увеличения разнообразия структур и функций белков, в матричный синтез могли бы быть включены другие D-аминокислоты, что могло бы привести к усложнению генетического кода до триплетного и увеличению разнообразия структур и функций белков.

СПИСОК ОСНОВНЫХ РАБОТ ПО ТЕМЕ ДИССЕРТАЦИИ

  1. Исаева Г.А., Дмитриев А.В., Исаев П.П. Механизм местной анестезии: ориентационные эффекты на дальних расстояниях // Биофизика, 2000, Т.45, №6, с. 1066–1071.
  2. Исаева Г.А., Дмитриев А.В., Исаев П.П. Математическое моделирование межмолекулярных взаимодействий в системе анестетик-биомембрана // Вестник КГУ им. Н.А. Некрасова, 2000, Т.2, №2, с. 50–55.
  3. Исаева Г.А., Дмитриев А.В., Николаевский В.А., Исаев П.П. Дескрипторы молекулярной формы в исследованиях местноанестезирующей активности производных фенилпропиофенона // Прикладные информационные аспекты медицины, 2000, Т.3, №2, с. 46–50.
  4. Исаева Г.А., Дмитриев А.В., Исаев П.П. Поляризационные взаимодействия в системе анестетик-биомембрана: активность производных ацетанилида // Журнал физической химии, 2001, Т.75, №10, с. 1716–1720.
  5. Исаева Г.А., Дмитриев А.В., Исаев П.П. Анализ количественных соотношений структура - анестезирующая активность ацетанилидов с применением регрессионных и квантовохимических методов // Химико-фармацевтический журнал, 2001, Т.35, №6, с. 54–56.
  6. Dmitriev A.V., Isaeva G.A., Isaev P.P., Slukina Yu.L. Quantum-mechanical Model of Ion Motion in Gramicidin Channel of Membrane // International Journal of Quantum Chemistry, 2001, V.52, p. 300–310.
  7. Zainutdinov A.V., Rozhkov A.N., Isaeva G.A., Dmitriev A.V., Isaev P.P. Simulation of Nucleic Acids Equilibrium Geometry in the Outer Electrical Field // International Journal of Quantum Chemistry, 2001, V.52, p. 310–320.
  8. Исаева Г.А., Дмитриев А.В., Исаев П.П., Зайнутдинов А.В., Рожков А.Н. Влияние базиса на точность оценки дипольного момента молекулы ацетанилида // Журнал структурной химии, 2001, Т.42, №6, c. 1222–1225.
  9. Дмитриев А.В., Исаев В.П., Исаева Г.А., Казак Е.В. Молекулярное моделирование ионных потоков через функциональную мембрану // Вестник КГУ им. Н.А. Некрасова, 2002, №2, с. 8–13.
  10. Дмитриев А.В., Исаева Г.А., Исаев П.П., Барышников В.Г., Ласточкин А.В. Уровни энергии и волновые функции иона в грамицидиновых каналах // Биофизика, 2002, Т.47, №5, с. 864–868.
  11. Исаева Г.А., Дмитриев А.В., Исаев П.П. Взаимодействие местных анестетиков с модельными ионными каналами // Биофизика, 2002, Т.47, №3, с. 506–511.
  12. Дмитриев А.В., Исаева Г.А., Исаев П.П., Лузянин С.Е. Исследование ионных потоков через границу раздела раствор/мембрана // Конденсированные среды и межфазные границы, 2002, Т.5, №3, с. 35–40.
  13. Исаева Г.А., Дмитриев А.В., Исаев П.П. Моделирование поляризационных взаимодействий в системе спирт – биомембрана // Известия вузов. Сер. Химия и хим. технология, 2003, Т.46, №6, с. 101–103.
  14. Дмитриев А.В., Твердислов В.А. О методах расчета распределения потенциала в белковых порах // Биофизика, 2004, Т.49, №3, с. 506–510.
  15. Dmitriev A.V., Baryshnikov V.G., Markov I.V., Tverdislov V.A. Band and point statistical estimation of channelforming polypeptides potential / Progress in Chemometrics Research. 2005. USA, NY: Nova Science Publishers, P.30–45.
  16. Дмитриев А.В., Марков И.В., Барышников В.Г., Твердислов В.А. Об использовании приближенных силовых полей для расчета распределения электростатического потенциала мембранных каналов // Журнал структурной химии, 2005, Т.46, №5, с. 624–628.
  17. Дмитриев А.В., Твердислов В.А. О возможности существования и структурных особенностях зеркального антипода природной клетки // Препринт физического факультета МГУ им. М.В. Ломоносова, № 6/2005. Москва, 2005. 50 с.
  18. Дмитриев А.В., Исаев П.П., Твердислов В.А. Разделение дальних и ближних взаимодействий в расчетах распределения энергии ионов в мембранных каналах // Журнал структурной химии, 2006, Т.47, №2, с. 255–259.
  19. Дмитриев А.В., Марков И.В., Барышников В.Г., Твердислов В.А. Распределение энергии и ионная избирательность бактериального калиевого канала // Биофизика, 2006, Т.51, №4, с. 624–629.
  20. Исаева Г.А., Дмитриев А.В., Исаев П.П. Влияние вязкости растворителя на молекулярную динамику грамицидинового канала // Известия вузов. Серия Химия и химическая технология, 2006, Т.49, №9, c. 40–42.
  21. Дмитриев А.В., Марков И.В., Твердислов В.А. Моделирование ионной избирательности потенциал-зависимого калиевого канала // Технологии живых систем, 2006, Т.3, №4, с. 39–42.
  22. Дмитриев А.В., Твердислов В.А. Моделирование последовательности кодонов белок-кодирующей области калиевого канала зеркальной клетки // Технологии живых систем, 2006, Т.3, №5, с. 39–41.
  23. Дмитриев А.В., Исаев П.П. Физическое объяснение водной проницаемости аквапорина AP1 // Вестник КГУ им. Н.А. Некрасова, 2005, Т.5, №4, с. 17–20.
  24. Дмитриев А.В., Исаев П.П. Представление молекулы мембранного канала в системе координат с поворотной осью симметрии // Вестник КГУ им. Н.А. Некрасова, 2005, Т.5, №7, с. 4–7.
  25. Дмитриев А.В., Исаев П.П., Твердислов В.А. Влияние изомеризации аминокислотных остатков на структуру аквапорина // Журнал структурной химии, 2006, Т.47, №3, с. 578–580.
  26. Дмитриев А.В., Марков И.В., Твердислов В.А. Рацемизация бактериального калиевого канала и хиральная безопасность биосферы // Технологии живых систем, 2006, Т.3, №1, с. 5–8.
  27. Дмитриев А.В., Марков И.В., Твердислов В.А. Структура и ионная избирательность открытого потенциал-зависимого калиевого канала // Журнал структурной химии, 2007, Т.48, №1, с. 143–145.
  28. Коротина А.С., Дмитриев А.В., Марков И.В., Твердислов В.А. Изменение структуры аквапорина в результате биологического старения организма // Известия вузов. Сер. Химия и хим. технология, 2007, Т.50, №5, с. 128–129.
  29. Коротина А.С., Дмитриев А.В., Марков И.В., Твердислов В.А. Применение смешанных энергетических профилей ионов в расчетах токовых характеристик калиевого мембранного канала // Известия вузов. Сер. Химия и хим. технология, 2007, Т.50, №6, с. 115–116.
  30. Твердислов В.А., Яковенко Л.В., Дмитриев А.В., Жаворонков А.А., Твердислова И.Л. Происхождение предшественников живой клетки. О двух фундаментальных асимметриях – ионной и хиральной / Проблемы регуляции в биологических системах. Биофизические аспекты / Под общей ред. А.Б. Рубина. Москва-Ижевск: Институт компьютерных исследований, 2007. с. 259–291.
  31. Дмитриев А.В., Зайнутдинов А.В., Рожков А.Н., Ткаченко К.Н., Исаева Г.А., Исаев П.П. Механизм местной анестезии: модельные взаимодействия в системе анестетик-мелиттин // Труды молодых ученых России: Сборник материалов 3-го Всероссийского медицинского конгресса. Ижевск: Изд-во Экспертиза, 2000. с. 16–18.
  32. Исаева Г.А., Дмитриев А.В., Исаев П.П., Зайнутдинов А.В., Рожков А.Н. Математическое моделирование электростатических взаимодействий в системе анестетик-биомембрана // Математика. Образование. Экология. Гендерные проблемы: Тезисы докладов Международной конференции. Воронеж: Изд-во ВГУ, 2000, с. 54–55.
  33. Исаева Г.А., Дмитриев А.В., Исаев П.П., Зайнутдинов А.В., Рожков А.Н., Ткаченко К.Н. Математическое моделирование взаимодействий местных анестетиков с грамицидиновыми каналами биомембраны // Физика и радиоэлектроника в медицине и экологии: Тезисы докладов 4-я Международной научно-технической конференции. Владимир: Изд-во Ин-та оценки природ. ресурсов, 2000, с. 47–52.
  34. Дмитриев А.В., Исаева Г.А., Исаев П.П. Математическое моделирование межмолекулярных взаимодействий в системе анестетик-биомембрана // Биохимическая физика на рубеже столетий: Тезисы докладов международной конференции. Москва: Изд-во Института биохимфизики РАН, 2000. с. 42.
  35. Исаева Г.А., Дмитриев А.В., Исаев П.П., Зайнутдинов А.В., Рожков А.Н. Влияние внешней среды на равновесную геометрию грамицидинового канала // Математика. Компьютер. Образование: Тезисы докладов 8-й Международной конференции. Москва: Изд-во Прогресс-Традиция, 2001. с. 285.
  36. Дмитриев А.В., Исаева П.П., Исаев П.П. Квантово-статистическое исследование распределения молекул анестетиков около поверхности биомембраны // Фундаментальные науки и прогресс клинической медицины: Тезисы докладов 2-й Конференции молодых ученых России с международным участием. Москва: Изд-во ММА им. И.М. Сеченова, 2001. с. 35–39.
  37. Дмитриев А.В., Зайнутдинов А.В., Рожков А.Н., Исаева Г.А., Исаев П.П. Влияние внешней среды на структурируемость HHSH-конформера грамицидина А // Молекулярная физика неравновесных систем: Материалы 3-й Всероссийской научной конференции. Иваново: Изд-во ИГХТУ, 2001. с. 52–56.
  38. Дмитриев А.В., Исаева Г.А., Исаев П.П., Слукина Ю.Л. Квантово-механическая модель движения иона в грамицидиновом канале мембраны // Компьютерное обеспечение химических исследований: Тезисы докладов Международного симпозиума. Москва: Изд-во ИОХ РАН, 2001. с. 49–50.
  39. Зайнутдинов А.В., Рожков А.Н., Исаева Г.А., Дмитриев А.В., Исаев П.П. Моделирование равновесной геометрии аминокислот во внешнем электростатическом поле // Компьютерное обеспечение химических исследований: Тезисы докладов Международного симпозиума. Москва: Изд-во ИОХ РАН, 2001. с. 59–60.
  40. Dmitriev A., Isaeva G., Isaev P. Analysis of residuals: statistical method in QSAR studies // Abstracts of the 7th Scandinavian Symposium on Chemometrics. 2001, V.3, p. 20–22.
  41. Исаева Г.А., Дмитриев А.В., Казак Е.В., Кузьминова Р.В., Исаев П.П. Математическое моделирование физиологического отклика в системе анестетик-мембрана // XVIII Съезд физиологического общества им. И.П. Павлова: Тезисы докладов. Казань: Изд-во КГМУ, 2001. c. 104–105.
  42. Дмитриев А.В., Барышников В.Г., Лузянин С.Е. Возможности и ограничения одномерной модели движения ионов в каналах биологических и модельных мембран // Биология – наука 21-го века: Тезисы докладов 6-й Пущинской конференции молодых ученых. Пущино: Изд-во ПНЦ, 2002. с. 28.
  43. Лузянин С.Е., Дмитриев А.В., Исаева Г.А., Исаев П.П. Теоретическое и экспериментальное исследование ионных потоков через мембрану // Биология – наука 21-го века: Тезисы докладов 6-й Пущинской конференции молодых ученых. – Пущино: Изд-во ПНЦ, 2002. с. 32.
  44. Барышников В.Г., Дмитриев А.В., Пухов Н.М. Моделирование электростатического поля каналообразующих пептидов полем заряженной цилиндрической поверхности // Биохимическая физика: тезисы докладов 2-й ежегодной молодежной конференции ИБХФ-ВУЗы. Москва: Изд-во ИБХФ РАН, 2002. с. 3.
  45. Дмитриев А.В., Барышников В.Г., Лузянин С.Е. О конфигурациях электростатического поля в ионных каналах мембран // Биохимическая физика: тезисы докладов 2-й ежегодной молодежной конференции ИБХФ-ВУЗы. Москва: Изд-во ИБХФ РАН, 2002. с. 4.
  46. Дмитриев А.В., Исаев П.П. Сравнительный анализ методов расчета потенциала димера грамицидина А // Биохимическая физика: тезисы докладов 2-й ежегодной молодежной конференции ИБХФ-ВУЗы. Москва: Изд-во ИБХФ РАН, 2002. с. 5.
  47. Лузянин С.Е., Марков И.В., Дмитриев А.В., Исаев П.П. О влиянии молекул анестетика на электростатическое поле мембранных каналов // Биохимическая физика: тезисы докладов 2-й ежегодной молодежной конференции ИБХФ-ВУЗы. - Москва: Изд-во ИБХФ РАН, 2002. с. 6.
  48. Дмитриев А.В., Барышников В.Г. О движении ионов в порообразующих белковых молекулах // Молекулярное моделирование: тезисы докладов 3-й Всероссийской конференции. - Москва: Изд-во ГЕОКХИ РАН, 2003. с. 9–10.
  49. Мелихов Н.Д., Шмелев Р.В., Дмитриев А.В., Барышников В.Г. О распределении молекулярного электростатического потенциала в полости порообразующих белков // Молекулярное моделирование: тезисы докладов 3-й Всероссийской конференции. - Москва: Изд-во ГЕОКХИ РАН, 2003. с. 94–95.
  50. Исаева Г.А., Исаев В.П., Дмитриев А.В. Квантовохимическое исследование проводимости ионных каналов биологических мембран // Молекулярная биология, химия и физика гетерогенных систем: Материалы 7-й Международной конференции, Москва-Плес. 2003. Иваново: Изд-во ЮНОНА, 2003. с. 49–54.
  51. Дмитриев А.В., Барышников В.Г., Марков И.В., Твердислов В.А. О механизмах ионной избирательности калиевого канала // 3-й Съезд биофизиков России: тезисы докладов. Воронеж: Изд-во ВГУ, 2004. с. 209–210.
  52. Исаева Г.А., Шмелев Р.В., Исаев П.П., Дмитриев А.В., Лапшина Н.П. Моделирование биологической активности местноанестезирующих и антиаритмических препаратов // 3-й Съезд биофизиков России: тезисы докладов. Воронеж: Изд-во ВГУ, 2004. с. 525–526.
  53. Дмитриев А.В., Марков И.В., Твердислов В.А. Моделирование третичной структуры функционально эквивалентных изомеров трансмембранных белков // 4-я Всероссийская конференция "Молекулярное моделирование": тезисы докладов. Москва, 2005. с. 35–37.
  54. Марков И.В., Дмитриев А.В. Разделение дальних и ближних взаимодействий в расчетах распределения энергии в аксиально-симметричных мембранных каналах // Международная конференция «Ломоносов-2005»: тезисы докладов. Москва, 2005. с. 40–41.
  55. Марков И.В., Дмитриев А.В. Предсказание первичной и третичной структуры D-изомеров модельных белков функционально эквивалентных природным мембранным белкам // Международная конференция «Ломоносов-2005»: тезисы докладов. Москва, 2005. с. 42–44.

[1] Под хирально модифицированными белками мы понимаем белки, в которых проведена замена их L-аминокислот на соответствующие D-аминокислоты.

[2] Protein Data Bank, Brookhaven National Laboratory, USA



 



<
 
2013 www.disus.ru - «Бесплатная научная электронная библиотека»

Материалы этого сайта размещены для ознакомления, все права принадлежат их авторам.
Если Вы не согласны с тем, что Ваш материал размещён на этом сайте, пожалуйста, напишите нам, мы в течении 1-2 рабочих дней удалим его.