WWW.DISUS.RU

БЕСПЛАТНАЯ НАУЧНАЯ ЭЛЕКТРОННАЯ БИБЛИОТЕКА

 

Молекулярно-генетические механизмы повышенной устойчивости бактерий к потенциально-летальным повреждениям днк

САНКТ-ПЕТЕРБУРГСКИЙ ГОСУДАРСТВЕННЫЙ УНИВЕРСИТЕТ

На правах рукописи

ВЕРБЕНКО Валерий Николаевич

МОЛЕКУЛЯРНО-ГЕНЕТИЧЕСКИЕ МЕХАНИЗМЫ

ПОВЫШЕННОЙ УСТОЙЧИВОСТИ БАКТЕРИЙ

К ПОТЕНЦИАЛЬНО-ЛЕТАЛЬНЫМ

ПОВРЕЖДЕНИЯМ ДНК

03.00.15 – генетика

АВТОРЕФЕРАТ

диссертации на соискание ученой степени

доктора биологических наук

Санкт-Петербург

2009

Работа выполнена в отделении молекулярной и радиационной биофизики Петербургского института ядерной физики им. Б.П. Константинова РАН

Официальные оппоненты: доктор биологических наук, профессор

Михельсон Виктор Михайлович

доктор биологических наук, профессор

Газиев Ажуб Ибрагимович

доктор биологических наук, профессор

Квитко Константин Васильевич

Ведущее учреждение: ФГУП Государственный научный центр РФ Государственный научно-исследовательский институт генетики и селекции промышленных микроорганизмов “ГосНииГенетика”

Защита состоится ”____” _________ 2009 г. в ______ часов на заседании совета Д212.232.12 по защите докторских и кандидатских диссертаций при Санкт-Петербургском государственном университете по адресу 199034, Санкт-Петербург, Университетская наб., 7/9, Санкт-Петербургский государственный университет, биолого-почвенный факультет, кафедра генетики и селекции, аудитория 1.

С диссертацией можно ознакомиться в центральной библиотеке Санкт-Петербургского государственного университета.

Автореферат разослан ”_____”_________________ 2009 г.

Ученый секретарь

Диссертационного совета Д212.232.12

кандидат биологических наук Л.А. Мамон

ОБЩАЯ ХАРАКТЕРИСТИКА РАБОТЫ

Актуальность исследования. Молекулярно-генетические механизмы устойчивости бактериальных клеток к повреждениям ДНК представляют собой несомненный интерес как эволюционно консервативные системы защиты клеток прокариотов и эукариотов. Нерепарированные однонитевые повреждения ДНК вызывают ингибирование и дезинтеграцию репликативных вилок, приводящую к появлению потенциально-летальных двунитевых разрывов ДНК. В E. coli дезинтегрированные двунитевые вилки собираются заново благодаря RecBCD-пути рекомбинационной репарации через направляемую гомологией инвазию однонитевой ДНК в интактный сестринский дуплекс. Репарация как прямо индуцированных, так и возникших при дезинтеграции репликативных вилок двунитевых разрывов ДНК в E. coli возможна прежде всего в реплицированной части хромосомы.

Уровень радиорезистентности бактерий определяется эффективностью репарации двунитевых разрывов ДНК. Репарация двунитевых разрывов у E. coli идет по механизму гомологичной RecBCD-зависимой рекомбинации. RecBCD-путь репарации двунитевых разрывов за пределами репликативной вилки может рассматриваться как комбинация двух независимых событий репарации, вовлекающих гомологичную хромосому. RecBCD-путь рекомбинационной репарации двунитевых разрывов сопровождается значительной деградацией ДНК и ассоциирован с рестартом репликации. В клетках дикого типа возможна репарация двунитевых разрывов без участия RecBCD-пути. RecF-пути рекомбинационной репарации приписывается роль в заделке брешей, хотя и признается его способность репарировать двунитевые разрывы при выключении RecBCD-пути.

У высокорадиоустойчивой бактерии D. radiodurans нет экзонуклеазы RecBCD и репарация двунитевых разрывов идет по RecF-пути рекомбинационной репарации, либо по гипотетическому механизму зависимого от протяженного синтеза отжига нитей. Взаимоотношения несомненно главного RecBCD-зависимого пути рекомбинационной репарации двунитевых разрывов ДНК с альтернативными RecF- и RecE-путями репарации в E. coli еще не выяснены.

Механизмы повышенной радиорезистентности снова в центре внимания:

  1. обсуждается зависимый от протяженного синтеза отжиг нитей (ESDSA) как способ репарации двунитевых разрывов у высокорадиоустойчивой бактерии D. radiodurans,
  2. белок RecA из D. radiodurans обладает особенными свойствами,
  3. индукция стрессовой системы теплового шока приводит к эффекту термоиндуцированной радиорезистентности у клеток дикого типа,
  4. в условиях холодового шока (при переносе с 37о на 10о) повышается дифференциальная скорость синтеза белков RесА и GyrA (субъединица А ДНК-гиразы). Белки холодового шока рассматриваются как активаторы транскрипции и РНК-шапероны,
  5. взаимодействия стрессовых систем клетки с системами репарации повреждений ДНК до конца не изучены.

В решении актуальных вопросов могут оказаться полезными исследования мутантов кишечной палочки с повышенной радиационной устойчивостью, в которых может быть усилена функция RecF-пути при сохранении роли RecBCD-пути рекомбинационной репарации.

Моделью для молекулярно-генетического анализа факторов радиорезистентности стал радиоустойчиввый мутант E. coli Gamr444. Радиорезистентность мутанта Gamr444 зависит от recA+-lexA+-функций (Бреслер и др., 1984). Штаммы бактерий Gamr имеют пониженный уровень пострадиационной деградации ДНК (Бреслер и др., 1982). Мутация recF в большей степени снижает радиоустойчивость мутанта Gamr444, чем клеток дикого типа (Бреслер и др., 1984). Повышенный уровень белков теплового шока приводит к эффекту термоиндуцированной радиорезистентности у клеток дикого типа и rpoH-recA-зависимому росту радиоустойчивости у мутанта Gamr444 (Вербенко и др., 1986), при этом гены-регуляторы репарационной системы и белков теплового шока – recA и rpoH, соответственно, в мутантах Gamr не изменились (Бреслер и др., 1984; Вербенко и др., 1986).

Анализ штаммов Gamr позволил предположить, что усиление радиоустойчивости у мутанта Gamr444 обусловлено мутациями по меньшей мере 3 типов. Одна из них предотвращает избыточную пострадиационную деградацию ДНК, вторая повышает эффективность работы рекомбинационных систем репарации (особенно RecF) и третья повышает уровень белков теплового шока, играющих вспомогательную роль в репарации. Для того, чтобы наиболее полно изучить механизмы высокой устойчивости бактерий к ДНК-повреждающим факторам, необходимо исследовать свойства мутантных локусов, дающих фенотип Gamr.

Процесс деградации поврежденной нити ДНК играет важную роль в рекомбинационной репарации. Защиту от избыточной деградации ДНК, по-видимому могут осуществлять клеточные белки аналогичные белкам gam и gp2 фагов и T4. Плазмида pGam26, вероятно, несет клонированный мутантный ген, кодирующий клеточный ингибитор деградации ДНК, не совпадающий с белком RecA. Свойства этого продукта кажутся интересными для исследования.

Одним из факторов, лимитирующих репаративный потенциал бактериальных клеток, является сложный, разветвленный процесс рекомбинационной репарации. Существование различных путей рекомбинации (Clark, 1973) может приводить как к кооперативным, так и к конкурентным взамоотношениям генетических продуктов, использующих один и тот же субстрат. Полученные ранее данные указывают на то, что важной причиной повышения устойчивости клеток E. coli к летальному действию -излучения является увеличение эффективности работы SOS-системы и RecF-пути рекомбинационной репарации (Бреслер и др., 1984). Вместе с тем взаимоотношения различных путей рекомбинации при репарации повреждений ДНК остаются невыясненными и требуют дальнейших исследований.

Вклад стрессовых систем клетки в радиорезистентность не вызывает сомнения, однако механизмы усиления экспрессии остаются не выясненными.

Белок RecA оказывает плейотропный эффект и занимает центральное место в индуцибельной репарации. Этот белок, будучи хорошо изученным у E. coli, продолжает оставаться объектом сравнительного исследования у разных микроорганизмов. С точки зрения эффективной репарации ДНК несомненный интерес представляет RecA-подобный белок у высокорадиоустойчивой бактерии D. radiodurans (Battista et al., 1999, Kim et al., 2002, Narumi et al., 1999). Возможным способом повышения радиоустойчивости выглядит перенос гена recA и экспрессия гена recA из грамположительной бактерии D. radiodurans в клетках E. coli.

Целью работы являлось исследование молекулярно-генетических механизмов повышенной устойчивости бактериальных клеток к потенциально-летальным повреждениям ДНК – двунитевым разрывам, на примере радиоустойчивых мутантов Escherichia coli.

В задачи исследования входило: изучение роли различных путей рекомбинационной репарации и прежде всего генов RecF-пути в повышении радиоустойчивости клеток, клонирование и изучение мутантных локусов gam, повышающих эффективность репарации; изучение вклада основных белков системы теплового шока в радиоустойчивость, исследование возможности активации RecA-зависимых функций в репарации, изучение роли мажорных белков холодового шока в феномене радиоустойчивости.

Научная новизна исследования состоит в том, что экспериментально установлена ассоциация репарации радиационно-индуцированных повреждений ДНК (включая двунитевые разрывы как основные летальные повреждения) с активностями RecBCD- и RecF-путей рекомбинационной репарации не только в клетках дикого типа, но и в радиоустойчивых мутантах. Есть несколько особенностей репарационных систем в мутантах Gamr: 1) при низких дозах облучения (на уровне D37) штаммы бактерий, имеющие пониженный уровень пострадиационной деградации ДНК, для исправления летальных повреждений не нуждаются в белке PriA и обширном ресинтезе, сопровождающем RecBCD-путь репарации; 2) при более высоких дозах (> 500 Гр) RecBCD-путь репарации становится существенным и у радиорезистентных мутантов; 3) относительный вклад SOS-функций значительно выше в мутантах Gamr по сравнению с диким типом и объем репарации ДНК и/или её эффективность значительно выросли; 4) вероятно, эти SOS-функции, крайне важные для репарации -повреждений, идентичны ферментам RecF-пути рекомбинационной репарации ДНК, о чем говорит перераспределение ролей RecBCD- и RecF-путей в пользу последнего, по крайней мере в диапазоне доз до 1 кГр, 5) мутации recO, recR, recQ, helD и uvrD, затрагивающие альтернативный RecF-путь репарации, гораздо сильнее сенсибилизируют мутант Gamr444, чем штамм дикого типа.

  • Понижение уровня экзонуклеазной деградации ДНК в необлученных клетках штамма Gamr444, обнаруженное прямым измерением экзонуклеазной активности фермента RecBCD и косвенным методом оценки выживаемости фагового мутанта T4 2-, согласуется с предположением о "конститутивном", т.е. присутствующим уже в необлученных клетках, ингибиторе пострадиационной деградации ДНК, который не контролируется репрессором SOS-системы LexA и не совпадает с белком RecA. Свойства плазмиды pGam26, несущей один из клонированных мутантных генов штамма Gamr444, свидетельствуют о том, что этот аллель способен ограничивать экзонуклеазную активность RecBCD в необлученных клетках дикого типа.
  • Мутантный локус радиорезистентности gam18 из штамма Gamr444 Escherichia coli, клонированный на плазмиде pGam18, компенсирует мутации в гене uvrD, кодирующем ДНК-геликазу II и относящемся к RecF-пути.
  • Белок RecA из высокорадиоустойчивой грамположительной бактерии Deinococcus radiodurans не способен компенсировать дефект гена recA грамотрицательной бактерии Escherichia coli K-12. Однако после серии последовательных облучений возрастающими дозами гамма-радиации клеток E. coli, несущих плазмиды с клонированными аллелями гена recA Deinococcus radiodurans, получены мутантные аллели recA-300 и rec30-212, комплементирующие делецию гена recA E. coli и, по-видимому, кодирующие мутантные белки RecADR, способные эффективно взаимодействовать с компонентами рекомбинационной репарации E. coli.
  • Доказано существование у радиоустойчивых мутантов E. coli Gamr смешанного RecBCD-RecFOR-пути рекомбинационной репарации ДР в гомологичных хромосомах, на котором происходит перераспределение ролей RecBCD- и RecF-путей в пользу последнего: ограничение активности экзонуклеазы V на RecBCD-пути сопровождается активацией геликазы на RecF-пути. Гиперпродукция белков теплового шока DnaK, DnaJ, CbpA, GrpE, ClpB и Lon создает благоприятные условия для репарации: ренатурации или гидролиза поврежденных протеинов. Белки холодового шока субсемейства CspA: CspA’ и CspG’, регулируют экспрессию генов, кодирующих БТШ, и генов SOS-регулона.

Положения, выносимые на защиту

1. Предполагается существование у радиоустойчивых мутантов E. coli Gamr смешанного RecBCD- и RecF-зависимого пути рекомбинационной репарации, на котором происходит перераспределение ролей RecBCD- и RecF-путей в пользу последнего: ограничение активности экзонуклеазы V на RecBCD-пути сопровождается активацией геликазы на RecF-пути.

2. Гиперпродукция белков теплового шока DnaK, DnaJ, CbpA, GrpE, ClpB и Lon создает благоприятные условия для репарации: ренатурации или гидролиза поврежденных протеинов. Модифицированные белки CspA’ и CspG’ системы холодового шока могут повышать устойчивость клеток E. coli как дикого типа, так и радиоустойчивого мутанта Gamr444, к летальному действию ионизирующей радиации и УФ-света, регулируя экспрессию генов и синтез белков холодового шока, теплового шока и RecA-зависимых функций, в частности белков RecF-пути репарации.

Теоретическое и практическое значение работы. Полученные данные демонстрируют существование эволюционно-консервативного механизма защиты клеток от опасных повреждений ДНК, включающего координированное действие различных репарационных и стрессовых систем бактериальной клетки. Работа вносит существенный вклад в разработку методов создания рекомбинантных плазмид, повышающих устойчивость клеток к генотоксичным факторам среды. В связи с задачей биологической очистки радиоактивных отходов штаммы микроорганизмов, способные селективно накапливать тяжелые металлы, в том числе и радионуклиды, должны обладать устойчивостью к повышенному радиационному фону. Клонированные мутантные локусы, повышающие эффективность репарации ДНК, дают возможность создания радиоустойчивых форм микроорганизмов для решения задач биоремедиации.

Результаты работы использованы при составлении программы курса “Регуляция транскрипции” и лабораторного практикума по молекулярной биологии для студентов кафедры биофизики Санкт-Петербургского государственного политехнического университета.

Апробация работы. Материалы диссертации были представлены на следующих отечественных и международных конференциях: 25th Annual Meeting European Society Radiation Biology, Stockholm, 1993, Molecular Genetics of Bacteria and Phages" в Колд-Спринг-Харборе (Cold Spring Harbor Laboratory) в 1995 г., Molecular Genetics of Bacteria and Phages" в Колд-Спринг-Харборе (Cold Spring Harbor Laboratory) в 1996 г., на 2 съезде ВОГиС в Санкт-Петербурге в 2000 г., на международной конференции, посвященной 100-летнему юбилею Н.В. Тимофеева-Ресовского "Современные проблемы радиобиологии, радиоэкологии и эволюции" в Дубне в 2000 г., на международной конференции "Проблемы радиационной генетики на рубеже веков" в Москве в 2000 г. и на школе-конференции “Генетика микроорганизмов и биотехнология” в Москве – Пущино в 2008 г.

Публикации. По материалам диссертации опубликовано 38 печатных работ в отечественных и зарубежных изданиях.

Структура и объем работы. Диссертация состоит из введения, обзора литературы, экспериментальной части, включающей материалы и методы, результаты и их обсуждение, заключения, выводов и списка цитированной литературы, насчитывающего 501 источник. Работа изложена на 310 страницах, иллюстрированных 81 рисунком и 19 таблицами.

СОДЕРЖАНИЕ РАБОТЫ

Глава 1. Обзор литературы.

Обзор литературы посвящен результатам изучения механизмов генетического контроля процессов репарации опасных повреждений ДНК. Наиболее подробно рассмотрены пути рекомбинационной репарации двунитевых разрывов ДНК. Особое внимание уделено вкладу стрессовых систем в радиорезистентность. Проведен сравнительный анализ свойств высокорадиоустойчивой бактерии D. radiodurans и радиорезистентных мутантов E. coli Gamr. В выводах по главе 1 сформулированы задачи работы.

Глава 2. Материалы и методы

Штаммы. В работе использованы следующие штаммы бактерий и фагов: 1) родительский штамм АВ1157 дикого типа E. coli K-12 (F- ara14 galK2 his-4 proA2 argE3 thi1 tsx33 thr1 leu6 lacY1 mtl1 xyl5 rpsL31 supE37); 2) происходящие из АВ1157 радиорезистентные мутанты Gamr 444 и Gamr 445 (Бреслер и др., 1980); 3) штаммы из коллекции лаборатории, 4) производные штаммы E. coli, сконструированные в данной работе методами конъюгации и трансдукции фагом Р1.

Плазмиды. Плазмиды, несущие мутантные локусы радиоустойчивости gam, а также компенсирующие температурочувствительность мутантов dnaK52::cat, dnaJ259, grpE280, groES617 и groEL44, получены методом клонирования in vivo с использованием мини-Ми-вектора MudII4042 (Groisman et al., 1984). Плазмида pGroESL (Tcr) получена от А.И. Грагерова (Москва), pKS5 (Apr recA+Dr ) и pKSrec30 (Apr recA670Dr) от д-ра I. Narumi (Япония), pUC19-recA1.1 (Apr recA+Ec) от профессора В.А. Ланцова (Гатчина).

Для выращивания клеток E. coli и S. derby применяли АП-бульон – аминопептид. Клетки выращивали при 32° С с аэрацией до концентрации 2108 клеток в 1 мл, осаждали центрифугированием и ресуспендировали в среде М9. Для выращивания клеток D. radiodurans применяли среду TGY. Твердая среда готовилась добавлением 1,5 % агара Difco к среде TGY. Титрование клеток производили на максимальном агаре, содержащем 1,5% агара и 25% аминопептида.

Бактериальные культуры выращивали с антибиотиками в соответствии с генотипом штаммов E. coli. Антибиотики добавляли в следующих концентрациях (мкг/мл): ампицилин (Ap) – 50, канамицин (Km) – 40, тетрациклин – 30, хлорамфеникол (Сm) – 25.

Методы. В работе были использованы традиционные методы генетики бактерий и ряд молекулярно-биологических методик.

Трансдукция и конъюгация. Перенос мутаций из донорных штаммов в реципиенты АВ1157 и Gamr производили с помощью трансдукции фагом P1 vir и методом конъюгации по модификации известных методик (Маниатис и др., 1984, Миллер, 1976).

Клонирование локусов Gamr. Метод клонирования in vivo основан на транслокации ДНК из хромосомы на плазмидный вектор с помощью транспозонного фага Mu (Groisman et al., 1984) в виде его варианта мини-MudII4042, содержащегося на многокопийной плазмиде рВС4042 с репликоном rep15A. Cлучайные библиотеки генов штамма Gamr444 на плазмидном векторе обогащались рекомбинантными клонами, несущими клонированные мутантные аллели Gamr двумя способами: выделением радиорезистентных клонов клеток с помощью повторяющихся циклов -облучения-подращивания (Бреслер и др., 1980, Erdman et al., 1961) и разработанным методом для селекции рекомбинанных “доминантных” плазмид.

Изучение зависимости выживаемости клеток от дозы - и УФ-излучения. Облучение клеток в экспоненциальной фазе роста производили в среде М9 при 4о в ледяной бане на установке “Исследователь” -лучами 60Со при мощности дозы 13 – 70 Гр/мин или при комнатной температуре в тонком слое в чашке Петри ультрафиолетовым светом на установке “Хромотоскоп” при мощности дозы 670 мДж/м2/сек в диапазоне 200 – 315 нм. Облученные клетки после разбавления в среде М9 рассевали на АП-агар и подсчитывали число колоний через 24 – 48 часов.

Определение экзонуклеазной активности. Из неочищенного лизата клеток выделяли фракцию, содержащую фермент RecBCD, с помощью гель-фильтрации на колонке из сефакрила S-200 ("Pharmacia"). Инкубацию 3H-дНТФ с различными клеточными фракциями проводили в 50 мМ трис-буфере, pH 7,0, содержащем 5 мМ MgCl2, 5 мM 2-меркаптоэтанола и 1 мM АТФ, и измеряли переход метки 3H в кислоторастворимую фракцию (Belyakova et al., 1993).

Определение относительной эффективности посева мутантного фага T4 2- проводили согласно (Rinken et al., 1992).

Определение частоты замещения хромосомного аллеля аллелем из плазмиды при участии трансдуцирующих фагов из библиотеки Кохары (Kohara et al., 1987) проводили по методу (Kulakauskas et al., 1991).

Молекулярно-биологические методы. В ходе выполнения работы были использованы стандартные методы – трансформация бактерий, выделение плазмидной ДНК (Маниатис и др., 1984), электрофоретическое разделение плазмидной ДНК и белков (Маниатис и др., 1984, Laemmli and Favre, 1973), введение радиоактивной метки в белки и клеточную ДНК (Вербенко и др., 1986; Бреслер и др., 1982), полимеразная цепная реакция с праймерами производства “Синтол” (Москва) на ДНК-амплификаторе Eppendorf MasterCycler Personal, гибридизация ДНК рекомбинантной плазмиды с хромосомной библиотекой E. coli на мембране Escherichia coli Gene Mapping Membrane производства Takara Shuzo Co (Япония), секвенирование ДНК на секвенаторе ABI Prizm 370 в фирме “Хеликс” (Санкт-Петербург). Анализ секвенированных последовательностей проводили с помощью программы BLASTN Национального центра биотехнологической информации (США). Поиск потенциальных сайтов связывания белка-регулятора холодового шока CspA в геноме E. coli проводили с помощью программы Search, написанной Н.В. Клоповым в ПИЯФ РАН.

Математическая обработка результатов опытов. Все дозовые кривые о зависимости выживаемости клеток (S) от дозы -излучения (D) воспроизводили в трех – четырех независимых опытах и строили дозовые кривые выживаемости lgS = A+BD методом наименьших квадратов, рассчитывая параметры A и B.

Глава 3. Результаты и обсуждение

3.1. Конститутивные и индуцибельные пути репарации и радиоустойчивость.

Роль RecBCD-пути рекомбинационной репарации, сопряженной с репликацией, в радиоустойчивости мутантов Gamr E. coli. Согласно предложенной Когомой модели рекомбинации ДНК, зависящей от репликации, белок PriA участвует в сопряженном с обширной деградацией ДНК RecBCD-пути репарации двунитевых разрывов ДНК на стадии сборки праймосом в D-петлях (промежуточных продуктах обмена нитей на концах двунитевого разрыва) для последующего переключения к индуцированному ресинтезу ДНК.

Фактор изменения дозы (ФИД) для исходных вариантов priA+ мутантов Gamr по сравнению с штаммом АВ1157 дикого типа, рассчитанный как отношение параметров В (углов наклона линейных участков дозовых кривых), равен 2,15±0,2 для Gamr445 и 3,2±0,4 для Gamr444. Дозовые кривые выживаемости подтверждают вывод о радиосенсибилизирующем действии мутации priA2::kan на все 3 родительских штамма (рис. 1). Это означает, что в радиорезистентных мутантах Gamr путь репарации летальных повреждений, в котором участвует белок PriA, играет не менее существенную роль в выживаемости, чем у клеток дикого типа. Это согласуется с сильным влиянием мутации recB21 на радиоустойчивость мутантов Gamr, указывающим на значительный вклад RecBCD-пути в репарацию ДР у этих мутантов (Бреслер и др., 1984в). Однако, если сравнивать параметры В для штаммов АВ1157 и Gamr на генетическом фоне priA-, то ФИД мутантов Gamr444 и Gamr445 по отношению к АВ1157 по-прежнему остается достаточно высоким: он равен 2,4±0,2 для первого и 2,5±0,4 для второго из радиорезистентных мутантов. Это указывает на существование у мутантов Gamr альтернативной системы репарации, не зависящей от белка PriA и, по-видимому, работающей без обширного ресинтеза ДНК. Этой альтернативной системой может являться RecF-путь рекомбинационной репарации.

 Влияние мутации priA2::kan на радиорезистентность-0

Рисунок 1. Влияние мутации priA2::kan на радиорезистентность клеток E. coli.

1 – () AB1157 priA+,

2 – () AB1157 priA2::kan,

3 – () Gamr444 priA+,

4 – () Gamr444 priA2::kan,

5 – () Gamr445 priA+,

6 – () Gamr445 priA::kan.

По оси абцисс – доза (кГр), по оси ординат – выживаемость (lgS).

Роль генов RecF-пути в радиационной устойчивости E. coli. В данном исследовании была экспериментально изучена роль ряда генов, потенциально важных для RecF-пути рекомбинационной репарации в мутантах Gamr: recA, recR, recO, recQ, uvrD, helD и recJ (табл. 1). Наиболее драматический эффект вызывает мутация recA13 в гене, кодирующем ключевой белок SOS-системы репарации и всех ветвей гомологичной рекомбинации: проявление фенотипа Gamr практически исчезает. Изучаемые гены могут быть разделены на два класса: 1) recR и recQ вносят более важный вклад в выживаемость после -облучения на фоне Gamr444, а не на фоне клеток дикого типа в интервале умеренных доз (при D37); recO и helD существенны для радиоустойчивого мутанта на экспоненциальном участке кривых выживаемости, а uvrD (SOS-регулон и RecF-путь) важен для репарации -индуцированных повреждений в клетках Gamr444 во всем интервале доз. RecBCD-путь репарации одинаково важен и почти абсолютно необходим как для дикого типа, так и для мутанта Gamr444, так как выключение экзонуклеазы RecJ, замещающей RecBCD в мутантах recBC sbcB с активированным RecF-путем, не сильно влияет на штамм Gamr444.

Таблица 1.

Влияние мутаций в генах RecF-зависимой рекомбинационной репарации на радиочувствительность клеток E. coli

Штамм A B (кГр-1) LD37 (Гр) D0 (Гр) ФИД37 ФИД0
AB1157 0,121 -2,954 180±10 119±7
Gamr444 0,788 -0,745 1500±100 490±37
AB1157 recA13 0,311 -25,601 25±1 18±1 0,139 0,151
Gamr444 recA13 0 -19,797 25±1 15±1 0,017 0.031
AB1157 recR252::Tn10 0,16 -8,875 67±10 44±3 0,372 0,370
Gamr444 recR252::Tn10 -0,684 -2,489 170±15 159±14 0,113 0,324
AB1157 recO1541::Tn5 -0,331 -2,333 92±11 155±20* 0,511 1,303
Gamr444 recO1541::Tn5 0,412 -1,633 590±5 253±14 0,393 0,516
AB1157 recQ::Tn3 0,501 -7,285 240±10 39±7 1,333 0,327
Gamr444 recQ::Tn3 -0,131 -1,342 480±30 200±12 0,320 0,408
AB1157 uvrD254::Tn5 -0,330 -2,570 110±6 155±8* 0,611 1,303
Gamr444 uvrD254::Tn5 0,412 -1,633 260±8 300±10 0,173 0,612
AB1157 helD1021::Tn10-9 -0,115 -2,635 103±4 146±5* 0,572 1,227
Gamr444 helD1021::Tn10-9 0,202 -1,353 605±40 243±17 0,403 0,496
AB1157 recJ284::Tn5 -0,017 -5,809 120±6 90±7 0,667 0,756
Gamr444 recJ284::Tn5 0,139 -0,923 890±27 370±11 0,593 0,755

* - кривая выживаемости lgS = f(D) L-образная.

3.2. Мутантные аллели радиорезистентности из штамма E. coli Gamr444: клонирование и характеристика.

Свойства клонированной рецессивной мутации gam12. Плазмида рGam12 несет рецессивную мутацию Gamr (gam12) штамма Gamr444. Один из радиоустойчивых клонов (штамм Gam12-20) по уровню радиорезистентности вдвое превосходит штамм АВ1157. Мутация gam12 влияет на экспрессию белков теплового шока, что доказано экспрессией гена -галактозидазы lacZ под контролем промотора гена теплового шока htpG.

Свойства клонированных доминантных аллелей gam. В четырех независимых сериях опытов были выделены 4 плазмиды (pGam18, pGam26, pGam43 и pGam55), которые стабильно передают промежуточный уровень радиорезистентности первичным трансформантам Cmr реципиента АВ1157 (Mu). Эффект “доминантных” плазмид рGamr является recA- и rpoH-зависимым: плазмиды pGam18 и pGam55 несколько сенсибилизируют штамм recA13, в то же время плазмиды pGam26 и pGam55 сохраняют некоторый радиопротекторный эффект (с ФИД = 1,5 – 2,0) и способны предотвращать пострадиационную деградацию ДНК крайне радиочувствительного мутанта AВ2463 (recA-). Следовательно, как и в случае родительского штамма Gamr444, эффект клонированных доминантных мутаций gam зависит от функционирования регулонов SOS и БТШ.

3.3. Конститутивное ингибирование деградации ДНК, вызванной ферментом RecBCD, в мутанте Gamr444 E. coli.

Чтобы доказать существование конститутивного (синтезирующегося независимо от облучения клеток) ингибитора экзонуклеазной деградации ДНК в клетках Gamr444 и проверить гипотезу, согласно которой этот ингибитор кодируется клонированным мутантным аллелем gam26, мы сравнили АТФ-зависимую экзонуклеазную активность в необлученных клетках Gamr444 и родительского штамма AB1157 и деградацию экзогенной линейной ДНК фага T4 в этих штаммах и в клетках дикого типа, несущих некоторые плазмиды с клонированными мутантными аллелями штамма Gamr444.

АТФ-зависимая деградация ДНК в клеточной фракции штамма Gamr444, содержащей экзонуклеазу V. После выделения методом гель-фильтрации на колонке из сефакрила S-200 фракции, содержащей белок RecBCD, АТФ-зависимая экзонуклеазная активность по отношению к двунитевой ДНК у мутанта Gamr444 понижена по сравнению с диким типом столь же сильно, как и у мутанта recBC, дефектного по ферменту RecBCD (рис. 2). Объяснение этих данных может состоять в том, что штамм Gamr444 имеет мутацию в локусе recBCD, понижающую экзонуклеазную активность RecBCD. В качестве контроля была использована трансдукция реципиента Gamr444 фагом P1, размноженным на клетках дикого типа с транспозонной вставкой argA::Tn10 в соседнем с recD гене (Schulz et al., 1983). Из 30 трансдуктантов Tcr штамма Gamr444, наследовавших вставку argA::Tn10, ни один не отличался от Gamr444 в спот-тесте на радиорезистентность. Таким образом, штамм Gamr444 не имеет мутаций в локусе recBCD, повышающих радиоустойчивость и влияющих непосредственно на белок RecBCD. Эти данные позволяют предположить, что у мутанта Gamr444 даже в отсутствие облучения клеток имеется фактор, понижающий экзонуклеазную активность фермента RecBCD, и что этот ингибитор прочно ассоциирован с комплексом RecBCD и не отделяется от экзонуклеазы V при гель-фильтрации.

 АТФ-зависимая экзонуклеазная активность в активной-1

 АТФ-зависимая экзонуклеазная активность в активной фракции-2

Рисунок 2. АТФ-зависимая экзонуклеазная активность в активной фракции по отношению к двунитевой [3H]ДНК. 1 – AB1157, 2 – SK508 recBC-, 3 – Gamr444.

По оси абсцисс – объем активной фракции в реакционной смеси, мкл; по оси ординат – экзонуклеазная активность, распад/мин103.

Оценка экзонуклеазной активности RecBCD с помощью фага T4 2-. Альтернативный, более простой метод изучения экзонуклеазной активности фермента RecBCD состоит в измерении эффективности посева фагов мутанта T4 2- с амбер-мутацией в гене белка 2, связывающегося с концами линейной двунитевой ДНК фага T4 и защищающего ее от деградации (Silverstein and Goldberg, 1976). Результаты определения относительной эффективности посева мутантного фага T4 2- на разных штаммах E. coli представлены в табл. 2. На газоне необлученных клеток мутанта Gamr444 эффективность посева T4 2- в 400 раз выше, чем на газоне родительского штамма AB1157 дикого типа, и лишь в 2 раза ниже, чем на газоне мутанта recB21, дефектного по экзонуклеазе V. Наиболее интересны данные, полученные с плазмидой pGam26, несущей клонированный аллель радиорезистентности gam26 мутанта Gamr444. Эта плазмида в клетках AB1157 дикого типа обеспечивает такую же высокую эффективность посева T4 2-, как и в бесплазмидном мутанте recB21, т.е. вызывает не зависящее от облучения клеток выключение экзонуклеазной активности RecBCD. Это согласуется с предположением, что клонированный мутантный аллель gam26 кодирует конститутивный ингибитор деградации ДНК. В качестве контроля использовали плазмиды pGam12 и pGam18. Первая из них, несущая мутацию, приводящую к конститутивной экспрессии белков теплового шока, не влияет на эффективность посева фага T4 2-. Вторая плазмида, несущая клонированный мутантный аллель повышенной радиоустойчивости мутанта Gamr444 gam18, вызывает небольшое, но достоверное уменьшение эффективности посева T4 2- по сравнению с бесплазмидным штаммом AB1157, которое устраняется мутацией-вставкой мини-Tn10-Kan, инактивирующей аллель gam18. Можно предположить, что некоторое снижение эффективности посева на хозяине Gamr444 по сравнению с AB1157/pGam26 обусловлено мутантным аллелем gam18, вероятно влияющим на геликазную активность.

Таблица 2.

Эффективность посева фага T4 2- на штаммах E. coli

Штамм Генотип Относительная эффективность посева
WA235 recA56 recB21 sup+ 1
WA237 recB+ sup+ 0,000065
AB1157 recB+ supE37 0,0011
Gamr444 gam12 gam18 gam26 0,489
AB1157(Mu cts)/pGam12 recB+ gam12 0,00152
AB1157(Mu cts)/pGam18 recB+ gam18 0,00041
AB1157(Mu cts)/pGam18::Kan recB+ gam18::kan 0,00670
AB1157(Mu cts)/pGam26 recB+ gam26 0,910

3.4. Свойства мутантного аллеля gam18.

Эффект плазмиды pGam18 на фоне дикого типа целиком устраняется мутацией в гене recB одной из субъединиц фермента RecBCD, играющего ключевую роль в RecBCD-пути гомологической рекомбинации, и не проявляется на RecE-пути рекомбинационной репарации в мутанте recBC sbcA. Однако, значительный радиозащитный эффект плазмиды, примерно такой же как в случае клеток дикого типа, наблюдается на генетическом фоне recBC- sbcB-, т.е. в условиях работы RecF-пути рекомбинационной репарации, и полностью устраняется на этом фоне мутацией recF. Более того, плазмида pGam18 вызывает достоверное повышение радиочувствительности мутанта recBC sbcB recF. Этот радиосенсибилизирующий эффект плазмиды выражен еще более сильно в случае дефектного по RecF-пути мутанта recBC sbcB recJ. Плазмида pGam18 не оказывает защитного действия на одиночные мутанты recF, recO и recR, а также recN и recQ, у которых также может быть затронут RecF-путь рекомбинации-репарации при сохранении альтернативного пути RecBC. Она не повышает выживаемость -облученных клеток мутанта recBC sbcB ruvB, дефектного по миграции ветвей холидеевских стыков.

Компенсация дефекта гена uvrD, кодирующего ДНК-геликазу II, мутантным аллелем gam18. Среди всех испытанных мутантов E. coli, у которых выведен из строя RecF-путь, убедительный защитный эффект плазмиды pGam18 наблюдался только на трех аллельных мутантах по гену uvrD, кодирующему ДНК-геликазу II (Richet et al., 1983) (рис. 3). Он проявляется как на фоне recB+, так и на фоне recBC- sbcB-, где достигает максимального значения. Таким образом, продукт мутантного аллеля gam18 работает на RecF-пути рекомбинационной репарации и эффективно компенсирует дефекты мутантов uvrD по ДНК-геликазе II.

Рисунок 3. Летальное действие -облучения на лизогенные по Mu штаммы E. coli K-12.

1, 2 – uvrD210, 3, 4 – uvrD152, 5, 6 – recB21C22 sbcB uvrD502, где 1, 3, 5 – бесплазмидные штаммы, 2, 4, 6 – штаммы, несущие плазмиду pGam18.

По оси абцисс – доза (кГр), по оси ординат – выживаемость (lgS).

Чтобы проверить, не несет ли плазмида pGam18 ген какой-либо из известных ДНК-геликаз, мы применили метод замещения хромосомного аллеля аллелем, клонированным на плазмиде (Kulakauskas et al., 1991), с помощью фагов библиотеки Кохары (Kohara et al., 1987), используя в качестве донора при трансдукции штамм с плазмидой pGam18::Kan, у которой локус gam18 помечен вставкой транспозона мини-Tn10-Kan. На этом штамме были размножены те клоны фагов из библиотеки Кохары, которые содержат гены известных ДНК-геликаз. Наибольшая частота переноса аллеля gam18::kan из плазмиды pGam18::kan в хромосому наблюдалась с фагом, несущим ген uvrD, и в меньшей степени с фагами, несущими гены rep или priA.

3.5. Природная плазмида pSD89 (Cmr) из S. derby K89, повышающая радиоустойчивость штаммов E. coli K-12.

Штамм E. coli Z805 (r-m+) был использован как промежуточный хозяин плазмиды pSD89 (Cmr) из Salmonella derby K89, чтобы избежать ее рестрикционной деградации при трансформации клеток E. coli. Этот штамм после трансформации к хлорамфениколустойчивости проверялся на приобретение неселектируемого маркера радиоустойчивости и оказался более устойчивым к -лучам (ФИД = 2,5 при S = 10-3) по сравнению с реципиентом.

Указание на повышение ДНК-полимеразной активности в S. derby K89 по сравнению с S. derby K82 (Саркисян и др., 1985) определило выбор мутанта E. coli по ДНК-полимеразе I как объекта для трансформации плазмидой pSD89 (Cmr). Трансформированные ею клетки polA6 приобретают более высокую устойчивость к летальному действию УФ-света, но компенсация дефекта по репарации является неполной. Более высокая защитная эффективность плазмиды в области малых доз проявляется в сигмоидальном характере кривых выживаемости. Плазмида pSD89 (Cmr) подобным же образом компенсирует дефект, вызванный мутацией recA13. Плазмида не оказывает влияния на чувствительность к УФ-свету мутанта uvrA и, что особенно показательно, мутанта umuC. Изучение летального действия -лучей подтверждает, что плазмида pSD89 (Cmr) в значительной мере компенсирует дефекты по репарации, вызванные мутациями в генах polA и recA, хотя плечо на кривых выживаемости выражено в меньшей степени, чем при облучении УФ-светом. В то же время на радиочувствительность клеток дикого типа эта плазмида оказывает лишь небольшое влияние.

Компенсация дефекта в гене polA плазмидой pSD89 (Cmr) была проверена по восстановлению способности плазмиды pBR322, имеющей polA-зависимый репликон, размножаться при непермиссивной температуре в клетках температурочувствительного по ДНК-полимеразе I штамма polA12 (ts), трансформированного плазмидой pSD89 (Cmr). Эффективность посева на агар с тетрациклином при 43о C клеток polA12 (ts)/pBR322 (Tcr Apr)/pSD89 (Cmr) составила 100 % по сравнению с 32оC, тогда как эффективность посева polA12 (ts)/pBR322 при 43оC равнялась нулю. Этот результат позволяет предположить, что природная плазмида pSD89 (Cmr) несет гомолог гена polA.

3.6. Влияние мутаций в структурных генах, кодирующих белки теплового шока, на радиорезистентность штаммов E. coli.

Систематические исследования влияния мутаций в структурных генах, кодирующих главные БТШ на радиочувствительность Е. coli до сих пор не проводились. Мы изучили влияние мутаций в генах, кодирующих семь главных БТШ: dnaK, dnaJ, cbpA, grpE, groES, groEL и clpB на чувствительность клеток Е. coli с нормальным репаративным генотипом и радиорезистентных мутантов Gamr с целью установить роль индивидуальных БТШ в природной и термоиндуцированной радиорезистентности и повышенной радиоустойчивости штаммов Gamr.

Как и в случае клеток с нормальным репаративным генотипом, наиболее сильное влияние на радиорезистентность мутантов Gamr оказывает мутация dnaK52. При введении ее в геном наиболее резистентного мутанта Gamr444 повышенная радиоустойчивость полностью устраняется (рис. 4)

Мутация dnaJ259, вызывающая заметный радиозащитный эффект на генетическом фоне дикого типа, приводит к почти полному исчезновению повышенной радиоустойчивости штамма Gamr444. Мутация в гене-гомологе cbpA вызывала радиосенсибилизацию штамма Gamr444, но не дикого типа. В гораздо меньшей степени выражена радиосенсибилизация штамма Gamr444, вызванная дополнительными мутациями groES617, groEL44 и grpE280: соответствующие варианты в 1,5 – 2 раза более -чувствительны по сравнению с Gamr444. Дополнительная мутация в субъединице АТФ-зависимой протеазы clpB радиосенсибилизировала штамм Gamr444, но не дикий тип.

Рисунок 4. Летальное действие -изучения на штаммы Е. coli Gamr444 с дополнительными мутациями в генах, кодирующих БТШ.

1 – Gamr444, 2 – Gamr444 grpE280, 3 – Gamr444 dnaJ259, 4 – Gamr444 cbpA, 5 – Gamr444 clpB, 6 – Gamr444 dnaK52::Cmr, 7 – контроль АВ1157.

По оси абсцисс – доза -лучей (кГр), по оси ординат – логарифм выживаемости (lgS).

3.7. Рост радиоустойчивости бактериофагов как результат усиления экспрессии стрессовых систем клетки-хозяина.

Для анализа конкретных молекулярных механизмов, приводящих к повышению радиоустойчивости мутантов Gamr, были использованы в качестве “зондов” бактериофаги, инактивированные -лучами и УФ-светом. Известно, что реактивация клеткой-хозяином УФ-облученного фага сильно зависит от uvr-системы эксцизионной репарации, в меньшей степени от ДНК-полимеразы I и почти не зависит от Rec-функций клетки. В случае фага, инактивированного -лучами, в реактивации принимают участие продукты генов polA и lig. Вирулентный фаг T4 почти не чувствителен к реактивации клеткой-хозяином, хотя в его реактивации принимает участие клеточная ДНК-полимераза I. Установлено, что продукты генов теплового шока groES и groEL необходимы для мутагенной umuDC-зависимой ветви репарации УФ-повреждений. Мутации в этом опероне блокируют W-реактивацию УФ-облученного фага S13. Потребность в этих белках приписывается их участию в поддержании стабильности белка UmuC. Считается, однако, что другие БТШ за исключением Lon не влияют на УФ-резистентность клеток E. coli. Можно ожидать, что при повышении активности стрессовых систем клетки увеличивается эффективность репарации УФ- или -облученных фагов.

Денситометрия радиоавтографов электрофореграмм показала усиление экспрессии стрессовых систем в мутантах Gamr. Наиболее существенным отличием экспоненциально растущих при 32оС клеток мутантов Gamr от клеток дикого типа является наличие заметных пиков белков с кажущимися молекулярными массами 94, 84, 70, 69, 60 кД. Они были идентифицированы как белки теплового шока Lon, ClpB, HtpG, DnaK, LysU, так как синтез именно этой группы белков усиливается при переносе клеток AB1157 на 43оС и блокируется мутацией в гене-регуляторе rpoH. Другое отличие мутантов Gamr от дикого типа заключается в быстрой кинетике синтеза и элиминации белка с массой 40 кД после -облучения клеток. Этот пик не индуцируется в мутанте recA- и идентифицируется как белок RecA, играющий ключевую роль в дерепрессии SOS-регулона. В присутствии 35S-метионина сразу после облучения наблюдается усиление по сравнению с необлученным контролем полосы с мол. массой 40 кД только у радиоустойчивых мутантов. После 30 мин пострадиационной инкубации импульсное мечение показывает усиление синтеза этого белка у дикого типа, продолжение синтеза у наименее радиоустойчивого штамма Gamr445 и исчезновение этой полосы у гиперрезистентного мутанта Gamr444. Таким образом, усиление синтеза белка RecA и его элиминация отражают степень радиоустойчивости штаммов E. coli.

Мы проверили, как повышенная эффективность индукции белка RecA влияет на W-реактивацию фагов, инактивированных во внеклеточном состоянии при -облучении клеток Gamr. Зависимость коэффициента W-реактивации (k) от дозы лучей, которой были облучены клетки 3-х штаммов E. coli, представлены на рисунке 5. Следует отметить следующие обстоятельства: максимальное значение k для штамма AB1157 приходится на дозу 400 Гр и достигает 2, а у мутантов Gamr максимум достигает 2,7 для фага 80 vir и 3 для фага cI и находится в области больших доз (900 – 1200 Гр). Обращает на себя внимание то, что у мутантов Gamr более сильная, чем в диком типе, W-реактивация регистрируется в широком интервале доз от 300 до 2000 Гр. Таким образом, можно сделать вывод, что радиоустойчивые мутанты обладают более эффективной системой SOS-репарации -облученных фагов по сравнению с родительским штаммом.

Рисунок 5. Зависимость коэффициента W-реактивации -облученных фагов от дозы -лучей, которой были облучены клетки.

Фаг : 1 – AB1157, 2 – Gamr445; фаг 80: 3 – AB1157, 4 – Gamr444, 5 – Gamr445.

По оси абцисс – коэффициент W-реактивации (k), по оси ординат – доза -лучей (кГр).

3.8. Радиоустойчивость штаммов E. coli recA- с клонированными мутантными аллелями гена recA E. coli и D. radiodurans.

Для клонирования мутации в гене recA, дающей фенотип recAHcr (High capacity of reactivation), мы использовали метод обогащения радиоустойчивыми клонами популяции клеток E. coli recA, трансформированных плазмидой pUC19-recA+, несущей ген recA+. После 12 циклов -облучения, подращивания, выделения плазмиды и трансформации был выделен вариант плазмиды pUC19-recAHcr с большим радиопротекторным эффектом по сравнению с исходной плазмидой pUC19-recA+.

Сравнение наклонов (-В) кривых выживаемости lgS = f(D) для штаммов Z905 recA/pUC19-recAHcr и Z905 recA/pUC19-recA+ позволило определить фактор изменения дозы ФИД, характеризующий эффективность радиозащитного действия плазмиды pUC19-recAHcr (табл. 3). На генетическом фоне штамма Z905 recA эта плазмида не только полностью компенсирует делецию гена recA, но и дает дополнительный радиозащитный эффект, будучи в 1,8 раза более эффективной, чем исходная плазмида pUC19-recA+.

Плазмида pUC19-recAHcr передана также в мутант E. coli AB1157 lexA3 recA21, дефектный по индукции SOS-системы репарации. Все трансформанты Apr в спот-тесте мало отличались по радиоустойчивости от бесплазмидного lexA3 recA21. Это подтвердилось и при количественном анализе дозовых кривых выживаемости. В штамме AB1157 lexA3 recA21 плазмида pUC19-recAHcr вызывала радиозащитный эффект с фактором изменения дозы ~1,9 по отношению к бесплазмидному реципиенту при выживаемости 37%, в то время как на фоне recA этот эффект был равен ~15,7.

Плазмида pUC19-recAHcr по сравнению с pUC19-recA+ эффективнее восстанавливала устойчивость к УФ-свету мутанта Z905 recA. Однако мутация lexA3 практически нивелировала различие в действии плазмид. Фактор изменения дозы при выживаемости 37% составлял 1,4, что в 10 раз меньше, чем при -облучении трансформанта Z905 recA/pUC19-recAHcr.

Таблица 3.

Сравнение радиозащитных свойств плазмид, повышающих радиорезистентность E. coli

Штамм ФИД
-Излучение (кГр-1)
АB1157 2,730±0,106
Z905 recA 27,820±2,075 0,098
Z905 recA/pUC19-recА+ 3,205±0,093 0,851
Z905 recA/pUC19-recАHcr 1,767±0,056 1,545
lexA3 recA21 18,147±0,109 0,150
lexA3 recA21/pUC19-recА+ 15,687±0,377 0,174
lexA3 recA21/pUC19-recАHcr 14,920±1,780 0,183
УФ-свет (сек-1)
АB1157 0,006±0,001
Z905 recA 0,072±0,007 0,085
Z905 recA/pUC19-recА+ 0,009±0,001 0,675
Z905 recA/pUC19-recАHcr 0,005±0,001 1,158
lexA3 recA21 0,084±0,004 0,073
lexA3 recA21/pUC19-recА+ 0,056±0,003 0,110
lexA3 recA21/pUC19-recАHcr 0,059±0,003 0,104

1 2 3 4

Электрофоретическое исследование лизатов клеток штамма Z905 recA, несущего плазмиды pUC19-recAHcr и pUC19-recA+ показало увеличение содержания белка RecA+ в штамме, несущем плазмиду pUC19-recAHcr (рис. 6).

Рисунок 6. Электрофоретическое распределение в ПААГ белков из лизатов штаммов Z905 recA (1), Z905 recA/pUC19-recА+ (2), Z905 recA)/pUC19-recАHcr (3), белок RecA (4).

Секвенирование плазмид pUC19-recAHcr и pUC19-recA+c универсальными праймерами к вектору pUC19 установило идентичность структурной части гена recA и полное соответствие последовательности, представленной в Национальном центре биотехнологической информации США. Вместе с тем, была обнаружена трансверсия A:T T:A в 20-м положении SOS-блока гена recA+ E. coli (рис. 7). Такая мутация нарушает комплементарность палиндрома, образующего SOS-блок. По этой причине мутант recAHcr была переименован как оператор-конститутивный мутант recAос, а мутация соответственно обозначена как recAо20.

precAHcr tagccatttt tactcctgtc atgccgggta ataccggata gtcaatatgt

precA+ tagccatttt tactcctgtc atgccgggta ataccggata gtcaatatgt

recA+ tagccatttt tactcctgtc atgccgggta ataccggata gtcaatatgt


+1 -10 -35

SOS box

precAHcr tctgttgaag caattaaact gtatgctcat acagtatcaa gtgttttgta

precA+ tctgttgaag caattatact gtatgctcat acagtatcaa gtgttttgta

recA+ tctgttgaag caattatact gtatgctcat acagtatcaa gtgttttgta


Рисунок 7. Нуклеотидная последовательность регуляторного района гена recA. Последовательности получены при использовании универсальных секвенирующих праймеров для pUC19 и плазмид pUC19-recAHcr и pUC19-recA+. Приведена также последовательность гена recA+ по данным НЦБИ. Подчеркнут стартовый кодон. Прописным шрифтом выделена трансверсия A:T T:A в конце SOS-блока.

Исследование свойств гена recA D. radiodurans в клетках E. coli. При введении плазмиды pKS5 с клонированным геном recA+ D. radiodurans и pKSrec30 c мутантным геном recA670 в клетки E. coli recA с полной делецией собственного гена recA все полученные трансформанты Apr не отличались в спот-тесте по радиорезистентности друг от друга и от штамма-реципиента. Радиозащитный эффект плазмид с геном recA D. radiodurans не превышал 1,25 как при экспрессии с собственного промотора, так и с промотора ластозного оперона pUV5 после индукции IPTG в клетках точечного мутанта recA56 и отсутствовал в мутанте ssb-1 (табл. 4). В качестве контроля была использована плазмида pUC19-rec1.1 с геном recA+ E. coli. На генетическом фоне штамма Z905 recA эта плазмида вызывает достоверный радиозащитный эффект, равный 8,17, практически восстанавливая радиоустойчивость до уровня штамма дикого типа AB1157 recA+.

Обработка трансформантов Z905 recA/pKS5 и Z905 recA/pKSrec30 с помощью индуктора лактозного оперона IPTG значительно усиливала экспрессию белка RecA по сравнению с базальным уровнем.

Таблица 4.

Сравнение радиозащитных свойств плазмид с различными аллелями гена recA в клетках E. coli

Штамм -В (кГр-1) ФИД
АB1157 3,058±0,087
Z905 recA 27,820±1,797 0,110
Z905 recA/pKSrec30 24,771±0,512 0,123
Z905 recA/pKSrec30 + IPTG 28,351±0,749 0,109
Z905 recA/pKS5 23,714±1,120 0,129
Z905 recA/pKS5 + IPTG 22,310±0,964 0,137
Z905 recA/pUC19-recА1.1 3,401±0,051 0,899
recA56 39,514±1,210 0,077
recA56/pKSrec30 30,286±0,659 0,010
recA56/pKSrec30 + IPTG 31,371±0,732 0,097
recA56/pKS5 30,929±1,402 0,099
recA56/pKS5 + IPTG 26,700±1,389 0,115
ssb-1 4,912±0,183 0,623
ssb-1/pKSrec30 6,001±0,183 0,510
ssb-1/pKSrec30 + IPTG 5,334±0,024 0,573
ssb-1/pKS5 4,702±0,039 0,650
ssb-1/pKS5 + IPTG 4,330±0,099 0,706

Белок RecA из высокорадиоустойчивой грамположительной бактерии D. radiodurans не способен компенсировать делеционную мутацию в гене recA грамотрицательной бактерии E. coli K-12. Однако после серии облучений возрастающими дозами гамма-радиации клеток E. coli recA, несущих плазмиды с recADR и recA670DR, получены мутантные аллели recA-300 и rec30-212, дающие радиозащитный эффект при гамма- и УФ-облучении.

Сравнение белков RecA E. coli и D. radiodurans показывает значительную степень подобия этих белков (~ 57%). Наибольшие отличия заключаются в N-концевом фрагменте из 16 аминокислот и С-концевой части белка.

ПОВЫШЕННАЯ РАДИОРЕЗИСТЕНТНОСТЬ И БЕЛКИ ТЕПЛОВОГО ШОКА.

Методом одномерного электрофореза в полиакриламидном геле обнаружено, что у радиорезистентных мутантов Gamr444 и Gamr445 Escherichia coli K-12 высокомолекулярные белки теплового шока гиперпродуцируются при 32-37° С и более интенсивно синтезируются при тепловом шоке (по сравнению с родительским штаммом АВ1157). При введении в геном штамма Gamr444 миссенс-мутации htpR15 в позитивном гене-регуляторе белков теплового шока его повышенная радиорезистентность исчезает, но восстанавливается при введении в штамм Gamr444 htpR15 плазмиды pKV3, несущей ген htpR+. Эти данные указывают на участие белков теплового шока в обеспечении повышенной радиорезистентности мутантов Gamr.

Ранее (Бреслер C.Е. и др., 1984в) нами показано, что в эффективной репарации -индуцированных летальных повреждений у гиперрадиорезистентных мутантов Gamr E. coli определяющую роль играет rесА+, 1ехА+-зависимая система SOS-репарации, в том числе сам продукт гена rесА, а также какие-то отличные от RecA SOS-индуцируемые функции. Мы высказали предположение о повышении индуцибельности генов SOS-системы у этих мутантов и о существовании у них конститутивных (не зависящих от 1ехА+) факторов, ограничивающих пострадиационную деградацию ДНК. С целью проверки этих гипотез мы решили сравнить белковый состав клеток мутантов Gamr и родительского штамма АВ1157 до и после -облучения, надеясь обнаружить гипериндукцию SOS-функций. Оказалось, однако, что мутанты Gamr отличаются от дикого типа не столько по SOS-белкам, сколько по компонентам другой стрессовой системы белкам теплового шока (БТШ) (Neidhardt F.С. et al., 1984). Данная работа посвящена доказательству участия системы БТШ в повышенной радиорезистентности мутантов Gamr.

ЭКСПЕРИМЕНТАЛЬНАЯ ЧАСТЬ И ОБСУЖДЕНИЕ

-Индуцированный синтез белка RecA.

Типичная картина электрофоретического распределения белков в валовых лизатах клеток высокоустойчивого штамма Gamr444 представлена на рисунке 00. -Облучение индуцирует синтез белка с мол. массой ~ 40 кД, который по всем признакам является белком RecA. Синтез этого белка усиливается уже через 5 мин после -облучения и ослабевает через 30 мин при дозе 0,1 кГр и через 60 мин при дозе 0,2 кГр. При более высокой дозе повышенный уровень экспрессии белка RecA наблюдается в течение 3 ч после облучения. У мутанта Gamr445, имеющего промежуточный уровень радиорезистентности, уже небольшая доза (50 Гр) вызывает усиленный синтез белка RecA, который продолжается в течение 60 мин (Рис. 00, а). В клетках дикого типа максимальная скорость синтеза белка RecA достигается только через 30 мин после облучения дозами 25 100 Гр (см. Рис. 00, б), что согласуется с литературными данными /00p?/. (Рис. 00, 00,00, 00 см. вкл. стр. 000).

В целом наблюдающиеся различия в кинетике синтеза белка RecA в -облученных клетках коррелируют с их радиоустойчивостью. Так, при -облучении клеток Gamr444 и Gamr445 одинаковой дозой 0,1 кГр (Рис. 00) синтез белка RecA прекращается через 30 мин у высокорезистентного мутанта и продолжается в течение 60 мин у менее -резистентного штамма. Ранее мы показали, что начальный уровень -индуцированных повреждений ДНК в клетках мутантов Gamr и дикого типа одинаков (Бреслер C.Е. и др., 1984в). Можно предположить, что более раннее выключение синтеза RecA у наиболее радиорезистентного мутанта отражает более эффективную репарацию повреждений ДНК, в том числе участвующих в индукции SOS-системы.

Белки теплового шока у мутантов Gamr.

Наиболее существенным отличием мутантов Gamr от клеток дикого типа оказались очень хорошо заметные полосы белков с мол. массами 94, 84, 66 и 56 кД (см. Рис. 00 00), интенсивность которых не зависела от -облучения и усиливалась при продолжительном росте клеток в среде ЕМ9 при 37 или 32° С (Рис. 00, а). Сравнение с литературными данными (Neidhardt F.С. et al., 1984) позволило предположить, что этот характерный набор белков принадлежит БТШ. Мы сопоставили эти белки, наиболее отчетливо проявляющиеся у мутантов Gamr в поздней экспоненциальной фазе роста, с типичными БТШ, индуцируемыми в клетках дикого типа сразу после переноса на 43° С (см. Рис. 00, б). Оказалось, что именно эти полосы появляются у штамма АВ1157 при тепловом шоке. В клетках Gamr444 в ранней экспоненциальной фазе роста индукцию тех же БТШ вызывает перенос на 43° С, причем, как показала денситометрия радиоавтографов электрофореграмм, у этого мутанта скорость синтеза БТШ в условиях теплового шока вдвое выше, чем у дикого типа (при нормировке на количество фактора элонгации EF-Tu (Meyer R.R. et al., 1982).

Приведенные данные показывают, что полосы белков 94, 84, 66 и 56 кД, характерные для мутантов Gamr уже при нормальной ростовой температуре (32 37° С), принадлежат соответственно БТШ Lon, HtpM, DnaK и GroEL (Neidhardt F.С. et al., 1984). Таким образом, мутанты Gamr, по-видимому, имеют измененную регуляцию синтеза по меньшей мере главных высокомолекулярных БТШ, которые у мутантов интенсивно синтезируются уже при нормальных температурах, особенно в поздней экспоненциальной фазе, а при 43° С индуцируются более активно, чем у дикого типа.

Роль белков теплового шока в радиорезистентности штаммов Gamr. Способность к сверхсинтезу БТШ вызвала у мутантов Gamr повышение устойчивости к летальному действию высоких температур. Так, после инкубации в течение 20 мин при 55° С выживаемость выращенных при 37° С клеток составляла 2,510-6 для штамма АВ1157, 2,510-3 для штамма Gamr445 и 410-3 для штамма Gamr444. Аналогичное повышение терморезистентности к 55° С у клеток дикого типа достигалось при индукции БТШ во время предварительной инкубации при 43° С (Yamamori Т., Yura T., 1982).

Чтобы установить, является ли повышенное содержание БТШ у -резистентных мутантов случайным совпадением или же оно коррелирует с повышенной радиоустойчивостью, мы с помощью трансдукции ввели в штамм Gamr444 температурочувствительную миссенс-мутацию htpR15 (Tobe T., et al., 1984) в гене позитивного регулятора системы БТШ (Grossman A.R. et al., 1984). Это привело к исчезновению полос БТШ у сконструированного штамма Gamr444 htpR15 как в конце экспоненциальной фазы роста, так и в условиях теплового шока (см. Рис. 00, в). Двойной мутант Gamr444 htpR15 по сравнению с -резистентным штаммом Gamr444 имеет значительно повышенную радиочувствительность, по которой он почти не отличается от клеток АВ1157 дикого типа и донорного штамма htpR15 (Рис. 00). Отметим, что, как было показано ранее (Бреслер C.Е. и др., 1984в), последние два штамма имеют одинаковую радиочувствительность. Лишь в области низких доз на дозовой кривой выживаемости штамма Gamr444 htpR15 сохранилось небольшое плечо, выраженное гораздо менее отчетливо, чем для штамма Gamr444. Таким образом, не вызывает сомнения, что повышенная радиорезистентность штамма Gamr444 в значительной степени зависит от его способности гиперпродуцировать БТШ в нормальных ростовых условиях. Вероятно, с этой способностью связано и отсутствие у мутанта Gamr444 термоиндуцированной радиорезистентности (Бреслер С.Е. и др., 1984а), которая у клеток дикого типа вызывается предрадиационной термообработкой, приводящей к накоплению БТШ (Бреслер C.Е. и др., 1984в). Сохранение небольшого начального плеча указывает на участие еще одного, htpR+-независимого фактора (возможно, конститутивного или SOS-индуцируемого ингибитора деградации ДНК (Бреслер C.Е. и др., 1984в) в радиорезистентности мутанта Gamr444.

Причины повышения “базального” уровня БТШ у мутантов Gamr окончательно выяснить не удалось. Можно было предположить, что у них изменился -фактор РНК-полимеразы 32-продукт гена htpR (Grossman A.R. et al., 1984), который стал более активным и при пониженных температурах. Оказалось, однако, что при введении дикого аллеля htpR+ в двойной мутант Gamr444 htpR15 в составе многокопийной плазмиды pKV3 (Tobe T., et al., 1984) его радиорезистентность почти полностью восстанавливается до уровня Gamr444. Аналогичное восстановление радиорезистентности у Gamr444 htpR15 наблюдалось и при конъюгационном замещении аллеля htpR15 на htpR+, т. е. оно не было связано с повышенным числом копий плазмидного гена htpR+. Таким образом, мутации радиорезистентности, скорее всего, не затрагивают сам ген htpR, а влияют на какие-то другие факторы регуляции системы БТШ. Тем не менее можно утверждать, что повышенная радиорезистентность штамма Gamr444 требует наличия нормальной субъединицы 32 РНК-полимеразы (Grossman A.R. et al., 1984), которая в обычных условиях не нужна для радиоустойчивости (Бреслер C.Е. и др., 1984в), даже если ее ген htpR+ содержится на многокопийной плазмиде (см. Рис. 00, кривая 4).

Одним из возможных механизмов радиозащитного действия системы БТШ, уже обсуждавшимся нами в связи с эффектом термоиндуцированной радиорезистентности (Бреслер C.Е. и др., 1984в), является защита ДНК от нуклеазной деградации в пострадиационный период.

Оказалось, что этот механизм для штамма Gamr444 несуществен, по крайней мере, в области умеренных доз (до 0,6 кГр). В этом диапазоне, соответствующем плечу дозовой кривой выживаемости штамма Gamr444 htpR15, деградация ДНК в -облученных клетках этого штамма остается столь же низкой, как и у штамма Gamr444 (Рис. 00). Лишь при большей дозе (1 кГр) мутация htpR15 заметно усиливает пострадиационную деградацию ДНК в клетках Gamr444 htpR15, причем этот эффект исчезает при введении гена htpR+ с плазмидой pKV3. Можно предположить, что в области низких доз деградация ДНК у мутанта Gamr444 и так подавлена конститутивным или SOS-индуцируемым ингибитором (Бреслер C.Е. и др., 1984в). Количество последнего, однако, становится лимитирующим при более высоких дозах, и тогда система БТШ оказывается способной выступить в роли альтернативного фактора подавления нуклеазной активности.

Таким образом, мы установили участие системы БТШ в обеспечении высокоэффективной репарации -индуцированных повреждений ДНК в клетках радиорезистентных мутантов Е. coli. He исключено, что механизм действия системы Htp у этих мутантов состоит в стабилизации нуклеоида повышенным количеством БТШ (Pellon J.R. et al., 1982). При этом возникающие под действием ионизирующей радиации двунитевые разрывы ДНК, защищенные от экзонуклеазной атаки и стабилизированные более плотной упаковкой нуклеоида, могут быть более эффективно исправлены в результате рекомбинационной репарации (Бреслер C.Е. и др., 1984в). Следует все же отметить, что создаваемые БТШ благоприятные для репарации условия реализуются в повышенную радиорезистентность мутантов Gamr лишь при наличии “обычных” систем репарации ДНК, включая рекомбинационные системы и rесА+, lехА+-зависимую SOS-систему (Бреслер C.Е. и др., 1984в).

3.7. Вклад белков холодового шока в радиоустойчивость.

Влияние инсерционной мутации в гене сspA, кодирующего главный белок холодового шока, на радиорезистентность клеток E. coli. Мы установили, что мутация, затрагивающая ген cspA E. coli, способна в гетерозиготном (на плазмиде) и в гомозиготном (в клеточной хромосоме) состоянии значительно повысить устойчивость к радиации клеток E. coli с нормальными системами репарации и синтеза белков теплового шока.

При введении плазмиды pCspA::Kan в штамм E. coli АВ1157 дикого типа все полученные трансформанты Кmr обнаружили в спот-тесте повышение радиорезистентности. Сравнение наклонов В кривых lgS = f(D) для штаммов AB1157 и AB1157/pCspA::Kan позволило определить ФИД, характеризующий эффективность радиозащитного действия плазмиды pCspA::Kan (табл. 5). В качестве контроля была использована плазмида pCspA+ – исходная родительская плазмида для pCspA::Kan, в которой ген cspA+ не разрушен вставкой кассеты Kmr. На генетическом фоне штамма АВ1157 эта плазмида вызывает радиозащитный эффект, но он является гораздо более слабым, чем для pCspA::Kan.

Таблица 5.

Параметры дозовых кривых выживаемости для штаммов E. coli

Штамм ФИД
-Излучение, (кГр-1)
АB1157 3,167±0,088
AB1157/pСspА::Kan 1,384±0,047 2,288
AB1157/pСspA+ 2,756±0,072 1,149
AB1157 cspA::Kan 1,083±0,061 2,924
JC7623 recB21C22 sbcB15 4,471±0,195
JC7623 recB21C22 sbcB15 cspA::kan 1,942±0,035 2,302
Gamr444 0,750±0,036
Gamr444/pСspА::Kan 0,912±0,052 0,882
Gamr445 1,406±0,038
Gamr445/pСspА::Kan 1,076±0,021 1,307
KS0160 Gamr 1,388±0,071
KS0160 Gamr/pСspА::Kan 1,033±0,039 1,344
AB2463 recA13 20,40±2,05
AB2463 recA13/pCspА::Kan 19,66±0,60 1,038
AB1157 rpoH15 3,355±0,058
AB1157 rpoH15/pCspА::Kan 2,835±0,093 1,183
УФ-свет (мин-1)
AB1157 0,477±0,015
AB1157 cspA::kan 0,341±0,003 1,399

Плазмида pCspA::Kan была передана также в два мутанта E. coli: 1) recA13, дефектный по гомологической рекомбинации и путям рекомбинационной и SOS-репарации; 2) rpoH15, дефектный по индукции системы белков теплового шока. В обоих случаях все трансформанты Kmr в спот-тесте не отличались по радиоустойчивости от бесплазмидных родителей. Это подтвердилось и при количественном анализе дозовых кривых выживаемости. В штамме АВ2463 recA13 плазмида pCspA::Kan не вызывала никакого радиозащитного эффекта. В мутанте rpoH, выращенном при 32о, плазмида pCspA::Kan вызывала достоверный небольшой радиозащитный эффект, который был наиболее заметным при больших дозах. Однако этот эффект оказался гораздо более низким, чем на генетическом фоне дикого типа.

Трансдуктанты АВ1157 cspA::kan проявляли заметное повышение радиорезистентности: фактор изменения дозы оказался близким к 3, т.е. в 1,3 раза больше, чем у гетерозиготного по мутации cspA::kan штамма АВ1157/pCspA::Kan. В гомозиготном состоянии мутация cspA::kan проявляет радиозащитный эффект как на RecF-, так и на RecBCD-пути рекомбинации-репарации. Штамм АВ1157 cspA::kan оказался достоверно более УФ-резистентным по сравнению с штаммом АВ1157. Однако, фактор изменения дозы R составлял 1,4, т.е. был заметно ниже, чем для -излучения.

Роль мутации в кластере генов cspH-cspG в регуляции белков теплового шока. Рецессивная мутация gam12, клонированная на плазмиде pBC4042, в гетерозиготном состоянии вызывает незначительное увеличение радиоустойчивости клеток дикого типа E. coli AB1157 с плазмидой pBC4042-gam12 и радиозащитный эффект становится заметным только в области больших доз. После пяти последовательных -облучений наблюдается значительный рост радиоустойчивости с фактором изменения дозы, равным ~3.37. По-видимому, радиация вызывает гомогенотизацию и переход от меродиплоида к gam12/gam12, так как известно, что облучение клеток E. coli recA+ с высокой частотой вызывает перенос аллелей из плазмид на хромосому (Mudgett and Taylor, 1986).

Мы картировали мутацию gam12. Гибридизация ДНК плазмиды pBC4042-gam12, меченной 32P, с набором фагов Кохары (Kohara et al., 1987), несущих упорядоченные фрагменты хромосомы, неожиданно показала несколько положительных сигналов (рис. 8). Их позиции были приписаны номерам “мини-набора” №№ 102, 103, 129, 130, 131, 225, 226, 404 и 615, что соответствует клонам Кохары 6H3, 22B12, 5A5, 3C7, 21C10, 4H11, 2F1, 9C2 и 10F5. Клоны 5A5 и 3C7 представляют собой фрагменты хромосомы, перекрывающиеся по локусу оперона lacZYA. Плазмида pBC4042 содержит оперон lacZ’YA, лишенный промотора (Groisman et al., 1984). Не исключено, что гибридизация с этими клонами может определяться последовательностью ДНК вектора. Однако общей особенностью клонов 6H3, 22B12, 21C10, 4H11, 2F1, 9C2 и 10F5 является присутствие инвертированной последовательности IS1, затем гена, кодирующего белок InsB транспозона, и экстрагенного палиндромного элемента. Такие вставки встречаются в 6 местах хромосомы E. coli: IS1A, IS1B, IS1C, IS1D, IS1G и IS1E. Следует отметить, что клоны 5A5 и 3C7 несут кроме локуса lacZYA также транспозон IS1B. Таким образом, клонированная мутация gam12, по-видимому, соседствует с одним из IS1-элементов в геноме E. coli. Анализ районов, прилегающих к этим IS1-элементам, позволил нам выбрать клоны 4H11 и 2F1 со вставкой IS1D, локализованной на 22,68 мин хромосомы с 5’-стороны от кластера генов cspH-cspG, кодирующих белки семейства холодового шока с негативным регулятором CspA. Мы предположили, что мутация gam12 расположена в этом районе, так как ранее установлено, что мутация-вставка сspA::kan в ключевом гене холодового шока вызывает большой радиозащитный эффект даже в присутствии хромосомного гена cspA+ дикого типа, и этот эффект зависит от генов recA и rpoH.

101 310

Рисунок 8. Картирование клонированного локуса хромосомы.

Гибридизация набора фагов Кохары с ДНК плазмиды pBC4042, меченной 32P и несущей аллель gam12. Вверху указано положение клонов на мембране.

Полимеразная цепная реакция с праймерами mugC-F3 и musI-R3 к ДНК на флангах вектора, содержащим последовательности фага Mu, позволила оценить размер клонированного на плазмиде pBC4042-gam12 фрагмента, как равный ~ 2500 п.н. (рис. 9). Это больше, чем район insB-cspH-cspG, который равен 1650 п.н. Использование встречно ориентированных праймеров cspG-F4 и cspG-R4 к гену cspG дало фрагмент размером ~570 п.н., что соответствует ожидаемой длине. Эти результаты позволили предположить, что клонированный фрагмент с локусом gam12 содержит последовательность, включающую повтор IS1D, гены insB, cspH и cspG.

Мы секвенировали локус gam12 с праймерами cspH-F5 и cspG-R5 к гену cspG. Полученная последовательность идентична на ~ 98% последовательности гена cspG. Выравнивание нуклеотидных последовательностей аллеля gam12 и гена cspG показало четыре нуклеотидные вставки во второй половине гена. Эти вставки приводят к появлению в последовательности преждевременного стоп-кодона TGA. Концептуальная трансляция такой последовательности дает N-концевой фрагмент белка CspG, состоящего из 41 аминокислоты вместо 70 (рис. 10), практически совпадающий с укороченным белком CspA, полученным после трансляции гена cspA со вставкой транспозона Tn903.

1 2 3 4 5

Рисунок 9. Электрофоретическое распределение ПЦР-продуктов в 0,6% агарозном геле.

Маркеры мол. весов ДНК /HindIII (1), pBC4042-gam12 (2, 4), pBC4042-gam12 после 5 -облучений (3, 5). 2, 3 – праймеры mugC-F3 и musI-R3, 4, 5 – праймеры cspG-F4 и cspG-R4. Верхняя стрелка – 2500 п.н., нижняя стрелка – 570 п.н.


CspG 1 msnkmtglvkwfnadkgfgfitpddgskdvfvhftaiqsnE 41

Gam12 (CspG) мsnkmtglvkwfnadkgfgfitpddgskdvfvhfirhpraq*41

СspA 1 MSGKMTGIVKWFNADKGFGFITPDDGSKDVFVHFSAIQNGS 40

СspA 1 MSGKMTGIVKWFNADKGFGFITPDDGSKDVFVHFSAIQNDG 41


CspG 42 efrtlnenqkvefsieqgqrgpaaanvvtl* 70

Gam12 (CspG) ------------------------------

СspA 42 gcnpgsatehssv*

CspA 42 YKSLDEGQKVSFTIESGAKGPAAGNVTSL* 70

Рисунок 10. Выравнивание аминокислотных последовательностей, полученных трансляцией локусов cspG, gam12, cspA со вставкой кассеты Tn903 и cspA. Курсивом показаны остатки, образующие мотивы связывания с РНК и ДНК (Schindelin, 1994). Аминокислоты, отличающие CspA от CspG, подчеркнуты; аминокислоты, появившиеся из-за сдвига рамки считывания, подчеркнуты волнистой линией.

Мутация gam12 не затрагивает мотивов белка kgfgfi и vfvhf, которым приписывается роль в связывании ДНК и РНК (Schindelin et al., 1994). Белки субсемейства CspA на 43% идентичны “домену холодового шока” эукариотических белков семейства “Y-блока” (Y-box). Все эти белки обладают способностью связываться с нуклеиновыми кислотами, влияя на транскрипцию, репликацию и репарацию или на эффективность трансляции мРНК.

Не исключая разные механизмы действия БХШ на экспрессию генов и синтез белка, мы проанализировали распределение в геноме E. coli нуклеотидного мотива ССААТ и комплементарного ATTGG с помощью программы Search. Список существенных генов, содержащих этот мотив в 5’-регуляторной области (меньше, чем 100 п.н. от блока -35), в промоторе (между блоками -10 и -35), в 5’-нетранслируемом районе РНК и структурной части гена представлен в таблице 6. Эти гены можно разделить на семейство генов собственно холодового шока: сspA, cspB, сspC, cspD, cspE, cspF, cspG, cspH, cspI, csdA, и rbfA; теплового шока: rpoH, dnaKJ, grpE, groES, htpG, lon, clpB, clpP, ddg, dksA, hslV, hslJ, htrA, htrC, ibpA, ibpB; гены репликации и клеточного деления: dnaA, dnaN, dnaX и ftsQ; регуляторные гены: oxyR, rpoS, ompR, osmC, hns, stpA (гомолог hns), asr, arcB, hipA, hupA, gcpE, greB и rob; и гены систем репарации и рекомбинации: recA, alkA, dinG, gyrA, polB, recC, recF, recO, recR через dnaX, recN, ruvA, ssb, uvrA, uvrB, uvrD и sulA. Вне нашего рассмотрения остаются гены метаболизма и транспорта, тоже содержащие мотивы ССААТ.

Таблица 6.

Классификация генов E. coli с областями, содержащими последовательность

Y-бокс для связывания СspA-подобных белков

Функция Гены/положение
5’-UAS Промотор 5’-UTR Структурная часть
Белки холодового шока cspF* сspA*, сspC* cspB*, cspD*, cspE* csdA, cspA*, cspB*, cspC*, cspD*, cspE*, cspF*, cspG*, cspH*, cspI*, rbfA
Белки теплового шока dnaKJ, grpE dnaKJ, htpG*, clpB*, clpP, ddg*, dksA, dnaK, groES*, grpE, hslV, hslJ, htpG*, htrA, htrC, ibpA, ibpB, lon, rpoH
Системы репарации, рекомбинации, репликации и клеточного деления alkA, gyrA*, dnaA, recO, ssb, uvrA, ruvA recO, polB, ssb, ftsQ recC*, recF, recR через dnaX, uvrD, dinG, ssb, ftsQ, dnaN, dnaX dinG*, gyrA*, polB, recA*, recF, recN, ruvA, ssb, ung, uvrA, uvrB, uvrD, intA, intB, ftsJ, ftsQ, dnaA, dnaN, dnaX, sulA
Регуляторные белки hns*, stpA, hipA, gcpE, ompR* arcB hns*, oxyR, rob, gcpE, greB asr, hns*, hupA, oxyR, ompR*, osmC, rob, rpoS, stpA

* - изменение экспрессии при холодовом шоке подтверждено протеомным анализом (Phadtare and Inouye, 2004).

Таким образом, нами идентифицирована рецессивная мутация gam12 из высокорадиоустойчивого штамма E. coli Gamr444. Эта мутация находится на 22,68 мин хромосомы в кластере генов cspH-cspG и по меньшей мере затрагивает ген cspG, вызывая сдвиг открытой рамки считывания с образованием стоп-кодона. Не исключено, что мутантный белок холодового шока CspG принимает участие в регуляции экспрессии стрессовых систем клетки при низкой температуре аналогично укороченному белку CspA.

Заключение. Устойчивость бактерий к наиболее опасному типу повреждений ДНК – двунитевым разрывам, определяется эффективностью рекомбинационной репарации. Современная модель рекомбинационной репарации двунитевых разрывов у E. coli основывается на RecBCD-зависимом пути репарации, сопряженном с реинициацией репликации, а RecF-пути отводит роль в репарации брешей или альтернативного механизма в отсутствие экзонуклеаз V и I. В данной работе представлены доказательства того, что, по крайней мере, у радиоустойчивых мутантов Escherichia coli Gamr возможно одновременное функционирование обоих путей репарации и только смешанный RecBCD-RecFOR-путь репарации способен исправлять множественные двунитевые разрывы в геноме этих бактерий.

Полученные данные говорят об эволюционном консерватизме унифицированного механизма рекомбинационной репарации повреждений ДНК у бактерий с повышенной устойчивостью к ДНК-тропным агентам. Предполагается, что высокая резистентность к ДНК-повреждающим агентам у радиоустойчивых мутантов кишечной палочки достигается формированием смешанного RecBCDFOR-пути рекомбинационной репарации, на котором происходит перераспределение ролей RecBCD- и RecF-путей в пользу последнего: активация геликазы на RecF-пути сопровождается ограничением активности экзонуклеазы V на RecBCD-пути. Дополнительно белки стрессовых систем теплового и холодового шока выполняют вспомогательную роль в ренатурации ключевых белков репарационных систем, деградации аберрантных белков и в регуляции экспрессии как SOS-регулона, так и аддитивных стрессовых систем.

Можно предложить следующий механизм реакции радиоустойчивых мутантов на действие ионизирующей радиации. Гамма-облучение вызывает повреждение ДНК и других компонентов клеток радиоустойчивого штамма, что является сигналом для частично конститутивных Gamr-функций (рис. 11). Активация этих функций приводит к изменению экспрессии генов SOS-системы репарации и RecF-пути рекомбинационной репарации, нарушению репликации и клеточного деления, изменению метаболизма, появлению устойчивости к окислительным агентам, усилению синтеза ренатурирующих белков, АТФ-зависимых протеаз и РНК-шаперонов и, возможно, других гипотетических систем. В итоге эти события приводят к повышению эффективности репарации потенциально-летальных повреждений ДНК и росту выживаемости клеток.

Рисунок 11. Реакция клеток радиоустойчивой бактерии на воздействие ионизирующей радиации.

ВЫВОДЫ

  1. Штаммы бактерий, имеющие пониженный уровень пострадиационной деградации ДНК, для исправления летальных повреждений при низких дозах не нуждаются в белке PriA и обширном ресинтезе, сопровождающем RecBCD-путь репарации двунитевых разрывов. Однако при более высоких дозах (> 500 Гр) этот путь репарации становится существенным и у радиорезистентных мутантов.
  2. Радиоустойчивость мутанта E. coli Gamr444 зависит от индуцибельной cистемы SOS-репарации и конститутивного RecBCD-зависимого пути репарации разрывов ДНК. Вместе с тем, установлено, что мутации recO, recR, recQ, helD и uvrD, затрагивающие альтернативный RecF-путь репарации, гораздо сильнее сенсибилизируют мутант Gamr444, чем штамм дикого типа.
  3. Обнаружено понижение уровня экзонуклеазной деградации ДНК в необлученных клетках штамма Gamr444 как прямым измерением экзонуклеазной активности фермента RecBCD, так и косвенным методом оценки выживаемости фагового мутанта T4 2-.
  4. Свойства плазмиды pGam26, несущей клонированный мутантный аллель gam26 штамма Gamr444, свидетельствуют о том, что его продукт способен ограничивать экзонуклеазную активность RecBCD в необлученных клетках дикого типа. Картирование показало, что он не совпадает с геном recA, который кодирует белок RecA, ингибирующий пострадиационную экзонуклеазную деградацию ДНК.
  5. Мутантный аллель gam18 радиорезистентного мутанта Gamr444, клонированный на плазмиде pGam18, повышает выживаемость -облученных клеток recBC- sbcB-, т.е. активен на RecF-пути рекомбинационной репарации.
  6. Частичная компенсация плазмидой pGam18 радиосенсибилизирующего эффекта мутаций в гене uvrD, кодирующем ДНК-геликазу II и также относящемся к RecF-пути, позволяет предположить, что мутантный аллель gam18 повышает ДНК-геликазную активность на предсинаптической стадии RecF-пути репарации -индуцированных двунитевых разрывов ДНК.
  7. Природная плазмида pSD89, выделенная из штамма S. derby, повышает радиоустойчивость клеток E. coli дикого типа, значительно компенсирует дефект по репарации в мутантах recA и polA, но не uvrA и umuC и несет гомолог гена polA.
  8. Повышенный базальный уровень основных белков теплового шока, а именно: DnaJ, CbpA, GrpE, ClpB, Lon, и в особенности DnaK, вызывает рост радиоустойчивости мутантов Gamr.
  9. Мутация в SOS-блоке оператора гена recA, снижающая связывание репрессора LexA, приводит к накоплению белка RecA в клетках и к росту устойчивости к летальному действию ионизирующей радиации и ультрафиолетового света.
  10. Экспрессия гена recA высокорадиоустойчивой грамположительной бактерии Deinococcus radiodurans не компенсирует делецию гена recA грамотрицательной бактерии Escherichia coli K-12.
  11. Модифицированные белки CspA и CspG системы холодового шока повышают устойчивость клеток E. coli дикого типа, а CspG также и радиоустойчивого мутанта Gamr444 к летальному действию ионизирующей радиации и УФ-света, активируя синтез белков холодового шока, теплового шока и RecA-зависимых функций, в частности белков RecF-пути репарации.
  12. Доказано существование у радиоустойчивых мутантов кишечной палочки смешанного RecBCDFOR-пути рекомбинационной репарации двунитевых разрывов ДНК, на котором происходит перераспределение ролей RecBCD- и RecF-путей в пользу последнего: ограничение активности экзонуклеазы V на RecBCD-пути создает условия для RecF-пути, который дополнительно стимулируется активацией геликазы. При этом белки стрессовых систем теплового и холодового шока выполняют вспомогательную и регуляторные роли в ренатурации или протеолизе поврежденных белков и избирательном усилении экспрессии генов.

Список публикаций по материалам диссертации.

Журналы, рекомендованные ВАК:

  1. Вербенко В.Н., Кузнецова Л.В., Бикинеева Е.Г., Калинин В.Л. Влияние мутаций в структурных генах белков теплового шока на радиорезистентность Escherichia coli. – Генетика, 1992, т. 28, №No 2, с. 99-110.
  2. Вербенко В.Н., Кузнецова Л.В., Калинин В.Л. Мутантные аллели радиорезистентности штамма Gamr444 Escherichia coli: клонирование и предварительная характеристика. – Генетика, 1994, т. 30, №No 6, с. 756-762.
  3. Вербенко В.Н., Калинин В.Л. Рост радиоустойчивости бактериофагов как результат усиления экспрессии стрессовых систем клетки-хозяина. – Генетика, 1995, т. 31, №No 12, с. 1630-1636.
  4. Вербенко В.Н., Исаханова К.Г., Калинин В.Л. Природная плазмида pSD89(Cmr) из Salmonella derby K89, повышающая радиоустойчивость штаммов Escherichia coli K-12. – Генетика, 1999, т. 35, № 3, с. 303-308.
  5. Вербенко В.Н., Крупьян Е.П., Шевелев И.В., Калинин В.Л. Конститутивное ингибирование деградации ДНК, вызванной ферментом RecBCD, у радиоустойчивого мутанта Gamr444 Escherichia coli K-12. – Генетика, 1999, т. 35, № 4, с. 438-443.
  6. Вербенко В.Н., Крупьян Е.П., Кузнецова Л.В., Калинин В.Л. Мутантный аллель gam18, участвующий в RecF-пути репарации у Escherichia coli K-12. – Генетика, 1999, т. 35, № 3, с. 309-313.
  7. Вербенко В.Н., Смольникова А.В., Калинин В.Л. Влияние нулевой мутации в гене priA на радиорезистентность Escherichia coli. – Генетика, 2000, т. 36, № 3, с. 318-321.
  8. Вербенко В.Н., Кузнецова Л.В., Смольникова А.В., Калинин В.Л. Влияние инсерционной мутации в гене сspA главного белка холодового шока на радиорезистентность клеток Escherichia coli. – Генетика, 2003, т. 39, № 6, с. 748-757.
  9. Вербенко В.Н., Кузнецова Л.В., Крупьян Е.П., Суслов А.В. Оператор-конститутивная мутация в гене recA повышает радиоустойчивость Escherichia coli. – Генетика, 2009, т. 45, № 8, с. 1048-1054.
  10. Вербенко В.Н., Кузнецова Л.В., Лучкина Л.А., Клопов Н.В. Мутация в кластере генов cspH-cspG повышает экспрессию белков теплового шока и SOS-системы репарации Escherichia coli. – Генетика, 2009, т. 45, № 9, с. 1194-1202.
  11. Вербенко В.Н., Кузнецова Л.В., Крупьян Е.П. Шалгуев В.И. Экспрессия гена recA Deinococcus radiodurans в клетках Escherichia coli. – Генетика, 2009, т. 45, № 10, с. 1324-1331.

Тезисы конференций, сборники и др.:

  1. Verbenko V.N., Kalinin V.L., Kuznetsova L.V. Mutant radiation resistant alleles from Escherichia coli Gamr444: cloning and preliminary characterization. – PNPI Research Report, 1990-91, PNPI, Gatchina, 1992. – 256 p., р. 174-176.
  2. Вербенко В.Н. Роль стрессовых систем бактериальных клеток в детерминировании устойчивости к неблагоприятным факторам среды. – Тезисы VI съезда ВОГИС, Минск, 1992.
  3. Kalinin V.L., Verbenko V.N., Kuznetsova L.V. Radiation resistant alleles from Escherichia coli Gamr444 mutant: cloning and preliminary characterization. – Abstr. 25th Ann. Meet. Eur. Soc. Radiat. Biol., Stockholm, 1993, p. 04:18.
  4. Вербенко В.Н., Бикинеева Е.Г., Калинин В.Л. Рост радиоустойчивости бактериофагов как результат координированного усиления экспрессии стрессовых систем. – Тезисы II Радиобиологического съезда, Киев, 1993, ч. 1, с. 178-179.
  5. Verbenko V.N., Kalinin V.L. Interplay of stress systems of Escherichia coli Gamr444 mutant in repair of -induced damage. – J. Cell Biochem., 1995, Suppl. 21A, p. 345.
  6. Verbenko V.N., Krupjan H.P., Kalinin V.L. Additive regulation of Escherichia coli stress systems in Gamr444 mutant. – Abstr. Meet. "Molecular Genetics of Bacteria and Phages", Cold Spring Harbor Lab., 1995. – 307 p., p. 268.
  7. Kalinin V.L., Kuznetsova L.V., Verbenko V.N. Is main cold stress CspA protein negative regulator of heat-shock proteins in E. coli? – Abstr. Meet. "Molecular Genetics of Bacteria and Phages", Cold Spring Harbor Lab., 1995. – 307 p., p. 128.
  8. Калинин В.Л., Вербенко В.Н., Кузнецова Л.В., Ахмедов А.Т., Крупьян Е.П. Радиорезистентные мутанты бактерий и клеточные стрессовые системы. – ПИЯФ-XXV. Основные направления научной деятельности, ОМРБ, ПИЯФ, Гатчина, 1995. – 264 с., с. 158-165. ISBN 5-86763-091-9.
  9. Kalinin V.L., Verbenko V.N., Kuznetsova L.V., Krupjan E.P. Properties of cloned dominant Gam18 allele. – PNPI Research Report, 1994-95, PNPI, Gatchina, 1996. – 344 p., p. 206-207. ISBN 5-86763-087-0.
  10. Kalinin V.L., Verbenko V.N., Krupjan E.P., Shevelev I.V. Properties of cloned dominant Gam43 allele. – PNPI Research Report, 1994-95, PNPI, Gatchina, 1996. – 344 p., p. 208. ISBN 5-86763-087-0.
  11. Kalinin V.L., Verbenko V.N., Isakhanova K.G. Natural plasmid pSD89 (Cmr) from Salmonella derby K89 protects Escherichia coli K-12 against radiation. – PNPI Research Report, 1994-95, PNPI, Gatchina, 1996. – 344 p., p. 209-210. ISBN 5-86763-087-0.
  12. Kalinin V.L., Verbenko V.N., Kuznetsova L.V. Overproduction of a subset of heat-shock proteins is sufficient for enhancement of radiation resistance in Escherichia coli. – Abstr. 44th Annual Meet. Radiat. Res. Soc., Chicago, 1996, p. 185.
  13. Verbenko V.N., Kalinin V.L., Krupjan H.P., Kuznetsova L.V. Recombinant plasmid pGam18 which carries a mutant allele involved in RecF pathway protects Escherichia coli wild-type cells from lethal effects of ionizing radiation. – Abstr. 44th Annual Meet. Radiat. Res. Soc., Chicago, 1996. – 196 p., p. 185.
  14. Kalinin V.L., Verbenko V.N., Kuznetsova L.V., Krupjan E.P. Rec functions in enhanced radiation resistance of E. coli Gamr444 mutant. – Abstr. Meet. "Molecular Genetics of Bacteria and Phages", Cold Spring Harbor Lab., 1996. – 178 p., p. 61.
  15. Verbenko V.N., Krupjan E.P., Shevelev I.V., Kalinin V.L. Mapping of the dominant mutation gam26 enhancing E. coli radioresistance. – Abstr. Meet. "Molecular Genetics of Bacteria and Phages", Cold Spring Harbor Lab., 1996. – 178 p., p. 114.
  16. Verbenko V.N., Kuznetsova L.V., Krupjan E.P, Kalinin V.L. The mutation enhancing heat-shock proteins synthesis in Escherichia coli K-12 at normal temperature is located within cspG gene. – Abstr. Meet. "Molecular Genetics of Bacteria and Phages", Wisconsin-Madisson, 1997.
  17. Kalinin V.L., Verbenko V.N., Kuznetsova L.V., Krup’yan E.P. Rec functions in enhanced radiation resistance of Escherichia coli K-12 Gamr mutants. – PNPI Research Report, 1996-97, PNPI, Gatchina, 1998. – 432 p., p. 296-297. ISBN 5-86763-087-0.
  18. Kalinin V.L., Verbenko V.N., Kuznetsova L.V., Krup’yan E.P. Preliminary mapping of Escherichia coli K-12 mutation enhancing heat-shock protein synthesis at normal temperature. – PNPI Research Report, 1996-97, PNPI, Gatchina, 1998. – 432 p., p. 298. ISBN 5-86763-087-0.
  19. Kalinin V.L., Verbenko V.N., Smol’nikova A.V. Influence of a null mutation in the priA gene on radiation resistance of Escherichia coli. – PNPI Research Report, 1996-97, PNPI, Gatchina, 1998. – 432 p., p. 299-301. ISBN 5-86763-087-0.
  20. Крупьян Е.П., Вербенко В.Н. Повышение эффективности RecF-пути рекомбинационной репарации ДНК у радиоустойчивого мутанта Escherichia coli Gamr444. – Тезисы 2 съезда ВОГиС, Санкт-Петербург, 1 - 5 февраля, 2000.
  21. Verbenko V.N., Kuznetsova L.V., Kalinin V.L. Radiation resistance of Escherichia coli depends on the cspA gene encoding the main cold shock protein. – Тезисы конференции, посвященной 100-летнему юбилею Н.В.Тимофеева-Ресовского "Современные проблемы радиобиологии, радиоэкологии и эволюции", ОИЯИ, Дубна, 6 - 9 сентября 2000 г.
  22. Verbenko V.N., Krup’yan E.P., Kuznetsova L.V., Kalinin V.L. Repeated "growth-irradiation" cycles induced a Gamr mutation at the cspG-cspH gene cluster of Escherichia coli. – Тезисы Международной конференции "Проблемы радиационной генетики на рубеже веков", Москва, 20 - 24 ноября 2000 г.
  23. Kalinin V.L., Smol'nikova A.V., Verbenko V.N. Influence of mutations in the cspA gene encoding the main cold shock protein on radiation resistance of Escherichia coli. – PNPI Research Report, 1998-99, PNPI, Gatchina, 2000. – 244 p., p. 231. ISBN 5-86763-033-1.
  24. Калинин В.Л., Вербенко В.Н. Гиперрадиорезистентность у бактерий. – Молекулярная генетика, биофизика и медицина сегодня. В сб. Бреслеровские чтения, ПИЯФ РАН, Гатчина, 2002. – 322 с., с. 43-49. ISBN 5-86763-197-4.
  25. Вербенко В.Н., Крупьян Е.П., Кузнецова Л.В. Калинин В.Л. Исследование ключевого гена рекомбинационной репарации recA высокорадиоустойчивой бактерии Deinococcus radiodurans в клетках Escherichia coli. – Основные результаты научных исследований 2000-2004, ПИЯФ РАН, Гатчина, 2005. – 258 с., с. 203-204. ISBN 5-86763-172-9.
  26. Вербенко В.Н., Кузнецова Л.В., Крупьян Е.П., Калинин В.Л. Роль стрессовых систем клетки в развитии радиоустойчивости у бактерий. – Молекулярная генетика, биофизика и медицина сегодня. В сб. Бреслеровские чтения II. ПИЯФ РАН, Гатчина, 2007. – 443 с., с. 396-404. ISBN 5-86763-057-9.
  27. Вербенко В.Н., Кузнецова Л.В., Крупьян Е.П., Суслов А.В., Шалгуев В.И. Селекция мутаций в гене recA, повышающих радиоустойчивость Escherichia coli. – Тезисы школы-конференции “Генетика микроорганизмов и биотехнология”, 20 – 24 октября 2008 г. Москва – Пущино, 2008. – 188 с., с. 27.

Подписано в печать

Формат 60Х84 1/16. Бумага офсетная. Печать офсетная.

Усл. печ. листов. Тираж 100 экз. Заказ №

Типография



 



<
 
2013 www.disus.ru - «Бесплатная научная электронная библиотека»

Материалы этого сайта размещены для ознакомления, все права принадлежат их авторам.
Если Вы не согласны с тем, что Ваш материал размещён на этом сайте, пожалуйста, напишите нам, мы в течении 1-2 рабочих дней удалим его.